Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate WP_076480183.1 BW971_RS13035 cation:dicarboxylase symporter family transporter
Query= TCDB::Q848I3 (444 letters) >NCBI__GCF_900156495.1:WP_076480183.1 Length = 482 Score = 371 bits (953), Expect = e-107 Identities = 197/437 (45%), Positives = 288/437 (65%), Gaps = 7/437 (1%) Query: 11 LYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSGIAGMQNMK 70 LY VIVA+ G+++G P G + LG F+ LIKM+I+PIIFCT+V GI ++ Sbjct: 45 LYLAVIVAVVAGVIVGLVAPGVGKDIAVLGTMFVSLIKMMISPIIFCTIVLGIGSVRKAA 104 Query: 71 SVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAAYVTAGKDQS 130 +VG+ GG A +YF ++STIAL +GLVV N++QPG+G+H+ ++ + A A + Sbjct: 105 TVGRVGGLAFVYFLVMSTIALAVGLVVGNLIQPGSGLHLSATSAGKGQQLAD-DAHEAGG 163 Query: 131 IVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDRFAHVMFNI 190 ++ F+ +IP +++ + G++LQ L +++ GFAL +G G+P+L I ++F I Sbjct: 164 LMDFVQGIIPESLLSSLTAGNVLQTLFVALLVGFALQAMGTTGEPILTAIGYIQKLVFRI 223 Query: 191 INMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLGAICRAHGF- 249 + M++ LAPIGA GA+A +G G ++ +L LM+ FY+TC++FV VLGA+ RA Sbjct: 224 LTMVLWLAPIGAFGAIAGVVGQTGWSAVGELLMLMVAFYLTCLIFVFGVLGAVLRAVAHV 283 Query: 250 SVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSFNLDGTSI 309 S+ KL+RY+ E L++ TSSSESALPR++ KME LG +++ VG+V+PTGYSFNLDGT+I Sbjct: 284 SIFKLVRYLAREYLLIFATSSSESALPRLIAKMEHLGVQRTTVGVVVPTGYSFNLDGTAI 343 Query: 310 YLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAVGHLP-- 367 YLTMA++F+A A + + Q LL+ ++++SKGAAGV+G+G LA L A H P Sbjct: 344 YLTMASIFVADALGKPLSLAEQFGLLVFMIVASKGAAGVSGAGLATLAGGLQA--HRPDL 401 Query: 368 VAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQAELASGGRAISDTR 427 + G+ LI+GIDRFMSEARA+TN GNAVAT++V W +D D++ LA T Sbjct: 402 LNGVGLIVGIDRFMSEARAVTNFSGNAVATLLVGSWTHTIDPDRVDHVLAGRDPFDETTM 461 Query: 428 EEDDLGVAEGPTPTTVK 444 DD G A G TPT K Sbjct: 462 VGDDHGAAVG-TPTDGK 477 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 623 Number of extensions: 39 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 482 Length adjustment: 33 Effective length of query: 411 Effective length of database: 449 Effective search space: 184539 Effective search space used: 184539 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory