Align Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)
to candidate WP_076478171.1 BW971_RS05915 amino acid ABC transporter permease
Query= uniprot:A0A0H3PA28 (219 letters) >NCBI__GCF_900156495.1:WP_076478171.1 Length = 289 Score = 111 bits (278), Expect = 1e-29 Identities = 68/207 (32%), Positives = 118/207 (57%), Gaps = 8/207 (3%) Query: 12 FLMQGLFLTLKIALATCIISIVFGTFLAITKNYGDRLSKFLAACYIDIFRNTPLLLWMLA 71 +L+ GL+ TLK A + +++++ GT L I + R+ + ++ +++FR P+L+ M+ Sbjct: 64 YLLPGLWGTLKAAAVSIVLALLVGTVLGIGRLSDHRIVRGMSGVIVEVFRAIPVLILMIF 123 Query: 72 ACFVLPVFFGQFPQA---FWGTI-GFSLYTSSVMAEIIRGGLNSIPKGQFEAAYSQGFGK 127 A ++ + FP + F + G +LY SV+AEIIR G+NS+P GQ EAA + G K Sbjct: 124 AYYLF-ARYAVFPSSQLPFAAVVFGLTLYNGSVIAEIIRSGINSLPSGQAEAASAIGLRK 182 Query: 128 FFTLFYIILPQTFRKIIPALLSQIVTTVKDTAYLAGLGIAELTYNSKTILAKLTSFEEIL 187 + I+LPQ ++PAL+SQ+V +KD+A +G E+ ++ + + F L Sbjct: 183 SQAMQLILLPQAVTAMLPALISQMVIALKDSALGYAIGYVEVV---RSGIQSASYFGNYL 239 Query: 188 AMIGVVAGIYFIICFSLSMLVRYYAKK 214 + VVA + +I F LS+L Y ++ Sbjct: 240 PALVVVAAVMIVINFGLSVLATYLERR 266 Lambda K H 0.331 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 289 Length adjustment: 24 Effective length of query: 195 Effective length of database: 265 Effective search space: 51675 Effective search space used: 51675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory