Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_076478048.1 BW971_RS07615 aspartate aminotransferase family protein
Query= reanno::SB2B:6938540 (460 letters) >NCBI__GCF_900156495.1:WP_076478048.1 Length = 462 Score = 212 bits (540), Expect = 2e-59 Identities = 139/447 (31%), Positives = 225/447 (50%), Gaps = 31/447 (6%) Query: 15 MDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYGRKSIA 74 +D H H ++ A+++ G I + G Y+WD G +LLD + L N+G+ + Sbjct: 29 LDRRHVFHSWSAQAEISPMG---ITASAGSYVWDGDGRRLLDFSSMLVNTNIGHQHPRVI 85 Query: 75 DAAYAQLQTL----PFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEANDTNL 130 A Q L P Y N + A RL IA PG ++++FFT G++AN+ + Sbjct: 86 AAIQRQAAKLCTVAPQYANDVR---SEAARL---IAERTPGDLDKIFFTNGGADANEHAV 139 Query: 131 RMVRRYWDLKGMPSKKTIISRKNAYHGSTVAGASLGG--MGFMHQQGDLPIPGIVHIDQP 188 RM R + ++ +++R +YHG T +L G + + GD G+VH P Sbjct: 140 RMARLH------TGRRKVLTRYRSYHGGTDTAINLTGDPRRWPNDHGD---SGVVHFFGP 190 Query: 189 YWF-GEGRDMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPFQGAGGVIIPPDSYWNEI 247 + + + E + L+ I G +AA + E G G++IPP Y + Sbjct: 191 FLYRSRFHAETEEQECARALDHLDEVIRMEGPSTIAAIVLETIPGTAGIMIPPPGYLRGV 250 Query: 248 KRILEKYNILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSDR 307 + + ++Y I++I DEV++GFGR+G WF+ +G+ PDL+T AKG+ SGY+P+GGV +S Sbjct: 251 RELCDRYGIVYIADEVMAGFGRSGTWFSVDLVGVTPDLLTFAKGVNSGYVPLGGVAISAA 310 Query: 308 VADVLISDGGEFAHGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRLQTLS 367 +A D + G TYSGHP+A A A+ I + +E +V + L L+ Sbjct: 311 IAATF--DHRPYPGGLTYSGHPLATAAAVATITAMADEDVVGNASRIGAEVIGPGLAELA 368 Query: 368 -AHPLVGEVRGMGMVGAIELVAD---KHSMVRFGSEISAGMLCREACIESGLVMRAVGDT 423 HP VGEVRG G+ A+ELV D + + +G+ +A AC GL+ A + Sbjct: 369 DRHPSVGEVRGCGVFWALELVRDRTTREPLAPYGASSAAMNDVVAACRSGGLLPFANVNR 428 Query: 424 MIISPPLCITRDEIDELIFKASQALSL 450 + + PP +T +E+ E + AL++ Sbjct: 429 IHVVPPCTVTAEEVREGLTVLDAALTV 455 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 577 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 462 Length adjustment: 33 Effective length of query: 427 Effective length of database: 429 Effective search space: 183183 Effective search space used: 183183 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory