Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_083709303.1 BW971_RS04230 ornithine--oxo-acid transaminase
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_900156495.1:WP_083709303.1 Length = 663 Score = 223 bits (568), Expect = 1e-62 Identities = 138/376 (36%), Positives = 204/376 (54%), Gaps = 27/376 (7%) Query: 76 LVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL-LDPLRAMLAKTLA 134 + D G ++DCL + N GHRNP V++AV +QL++ L S+ D LR A LA Sbjct: 290 ITDVDGDRYLDCLAAYSAVNFGHRNPTVLAAVTDQLSRLTLTSRAFHSDRLRPFCAD-LA 348 Query: 135 ALTPGKLKYSFFCNSGTESVEAALKLAKAYQS-----PRGKFTFIATSGAFHGKSLGALS 189 AL ++ N+G E+VE+ALK+A+ + P G T I G FHG+++ +S Sbjct: 349 ALCGKQMVLPM--NTGAEAVESALKVARKWGYERKGVPDGAATIIVAGGNFHGRTISIVS 406 Query: 190 ATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILP 249 + R F P PGFR VP+G+++A+ A++ D V AV++EP+QGE GV++P Sbjct: 407 FSDDPEARDGFGPFTPGFRSVPYGDVDAIAAAMD------DTVVAVLVEPVQGEAGVVVP 460 Query: 250 PPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPI 309 GYL +R+LCD ALMI DE+Q+G+GRTG A +H +V PD++ L KALGGGV+P+ Sbjct: 461 TDGYLPGIRRLCDAHSALMICDEIQSGLGRTGHTLAVQHWDVMPDMITLGKALGGGVIPV 520 Query: 310 GATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDG 369 A +A V VL P H +TFGGNPLA A + +L + + +A G L Sbjct: 521 SAVVADRSVLGVL--QPGQHGSTFGGNPLAAAVGQTVVGMLADGSWQRRAADLGAHL--- 575 Query: 370 FRQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTL---NNAKTIR 426 +L V RG G+ ++ VD G + R+ G L + T+R Sbjct: 576 HERLGGLIGHGVTAVRGLGLWAGVD-VDPSAG---TGKEICLRLAAEGVLAKDTHGSTLR 631 Query: 427 IEPPLTLTIEQCELVI 442 PPL +T ++ + + Sbjct: 632 FAPPLVITHDEIDWAV 647 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 715 Number of extensions: 36 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 663 Length adjustment: 36 Effective length of query: 423 Effective length of database: 627 Effective search space: 265221 Effective search space used: 265221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory