Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_076475547.1 BW971_RS00410 3-oxoacyl-ACP reductase
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >NCBI__GCF_900156495.1:WP_076475547.1 Length = 454 Score = 95.5 bits (236), Expect = 2e-24 Identities = 77/254 (30%), Positives = 117/254 (46%), Gaps = 18/254 (7%) Query: 8 KPRPGLRVFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLHAGIA--- 64 KP G V+ A GIG IAE A V D+ A EA S+ G A Sbjct: 210 KPLAGRVAVVTGAARGIGATIAEVLARDGAHVIAADIPAAG--EALSQTANKVKGTAFPI 267 Query: 65 DVSKQAQVDQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYF 124 DV+ + ++ + A + GG+D++VNNAGI + +D A+W++ + NL + Sbjct: 268 DVTAEDAGAKLAEHALERHGGIDIIVNNAGITRDK-LLANMDAARWDAVIGVNLIAPLQL 326 Query: 125 LRKAVPVLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRV 184 + V S A ++ +SS+AG G +T Y ++K ++GLV + A L + + Sbjct: 327 VNTLVEKGALKSGGA-VVDVSSIAGIAGNRGQTNYGTSKAGVIGLVDAYAPVLAEKGITI 385 Query: 185 NAILPGVVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASP 244 NA+ PG +E A IP A RE SL++ D+A + A+P Sbjct: 386 NAVAPGFIE----------TAMTAAIPL-ATREAGRLMSSLQQGGQTVDVAETVAYFANP 434 Query: 245 AGSNVTGQAISVDG 258 A S VTG + V G Sbjct: 435 ASSAVTGNVVRVCG 448 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 454 Length adjustment: 29 Effective length of query: 234 Effective length of database: 425 Effective search space: 99450 Effective search space used: 99450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory