Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_076476774.1 BW971_RS03935 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_900156495.1:WP_076476774.1 Length = 251 Score = 109 bits (272), Expect = 6e-29 Identities = 81/247 (32%), Positives = 119/247 (48%), Gaps = 11/247 (4%) Query: 16 LISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGV----ADVSDCAQ 71 +++GAA GIGAA+A+ G V + D+D A A TA ADVSD A Sbjct: 8 IVTGAARGIGAAVAKRLAADGLAVAVLDLDETACTEAVTAITDAGGSAIAVGADVSDEAA 67 Query: 72 VDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVPL 131 V +D ++LG +LINNAGI + + +W++ +G +L F R Sbjct: 68 VAAAVDRVATELGAPTVLINNAGILRDN-LLFKMSVDDWDKVLGVHLRGAFLMSRATQKH 126 Query: 132 LKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILPGV 191 + + A G I S LG + Y+A+K + G K+LAIELGP V NAI PG Sbjct: 127 MVD--ARWGRIVNLSSTSALGNRGQANYSAAKAGMQGFTKTLAIELGPFGVTANAIAPGF 184 Query: 192 VEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNISG 251 +E + + +A A +G+ F++ + +RR T D+A A F A +SG Sbjct: 185 IETD----MTAATAARIGVPFEEFIAARAAETPVRRGGTPADIANAASFFVGEAAGFVSG 240 Query: 252 QAISVDG 258 Q + V G Sbjct: 241 QVLYVAG 247 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 251 Length adjustment: 24 Effective length of query: 239 Effective length of database: 227 Effective search space: 54253 Effective search space used: 54253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory