Align ABC transporter for D-Glucosamine Hydrochloride, permease component 2 (characterized)
to candidate WP_083710231.1 BW971_RS16650 ABC transporter permease subunit
Query= reanno::pseudo6_N2E2:Pf6N2E2_2052 (220 letters) >NCBI__GCF_900156495.1:WP_083710231.1 Length = 589 Score = 101 bits (251), Expect = 3e-26 Identities = 70/213 (32%), Positives = 108/213 (50%), Gaps = 8/213 (3%) Query: 15 DTLLAGLGLGLSLALVSIAIGCVIGLAMAFALLSKHRVLRVLASVYVTVIRNTPILVLIL 74 D L GL L L++VS +G ++G+ +A A +S+ R LR A +Y + R P +V+IL Sbjct: 357 DLLKTGLPNTLILSVVSGVLGTILGMVLAVAGISRSRWLRWPARIYTDIFRGLPAVVVIL 416 Query: 75 LIYFALPSLGIRLDKLPSF---VITLSLYAGAYLTEVFRGGLLSIHKGQREAGLAIGLGE 131 ++ + + L + + L+L A AY+ E+FR G+ S+ GQ EA AIG Sbjct: 417 VVGLGIGPVVKNLTGNNPYWLGAVALALLAAAYIGEIFRSGIQSVDDGQLEASRAIGFSY 476 Query: 132 WQVKAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAV----PELTYYARKINVESYRV 187 Q V VP +R VLPAL N FISL KD+SL + + EL R +N ++ Sbjct: 477 RQSMRLVVVPQGVRRVLPALMNQFISLIKDSSLVYFLGLLASQRELFAVGRDLNAQTGN- 535 Query: 188 IETWLVTTALYVAACYLIAMLLRYFEQRLAIRR 220 + + +Y+ + L+ Y + RL R Sbjct: 536 LSPLVAAGLIYLVLTIPLTHLVNYIDHRLRTGR 568 Lambda K H 0.330 0.142 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 589 Length adjustment: 29 Effective length of query: 191 Effective length of database: 560 Effective search space: 106960 Effective search space used: 106960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory