Align ABC transporter for D-glucosamine, permease component 2 (characterized)
to candidate WP_076478171.1 BW971_RS05915 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21720 (220 letters) >NCBI__GCF_900156495.1:WP_076478171.1 Length = 289 Score = 95.1 bits (235), Expect = 1e-24 Identities = 61/203 (30%), Positives = 105/203 (51%), Gaps = 3/203 (1%) Query: 18 LWSGFLTSVQCSVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRFYVDLIRGTPVFVLVLAC 77 L G +++ + ++I+L L+G V G+ +R V++ R PV +L++ Sbjct: 65 LLPGLWGTLKAAAVSIVLALLVGTVLGIGRLSDHRIVRGMSGVIVEVFRAIPVLILMIFA 124 Query: 78 FYMAPALGWQIDA---FQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASKAIGLTFYQ 134 +Y+ + F A V GLTL+ GS +AEI+R + +LP GQ EA+ AIGL Q Sbjct: 125 YYLFARYAVFPSSQLPFAAVVFGLTLYNGSVIAEIIRSGINSLPSGQAEAASAIGLRKSQ 184 Query: 135 ALAYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFMTLEFYLF 194 A+ +LLPQA+ +LP ++ +K S L IG E++ S Q + L + Sbjct: 185 AMQLILLPQAVTAMLPALISQMVIALKDSALGYAIGYVEVVRSGIQSASYFGNYLPALVV 244 Query: 195 AGFLFFIINYAIELLGRHIEKRV 217 + +IN+ + +L ++E+R+ Sbjct: 245 VAAVMIVINFGLSVLATYLERRL 267 Lambda K H 0.330 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 289 Length adjustment: 24 Effective length of query: 196 Effective length of database: 265 Effective search space: 51940 Effective search space used: 51940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory