Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate WP_083710231.1 BW971_RS16650 ABC transporter permease subunit
Query= SwissProt::P0AER5 (224 letters) >NCBI__GCF_900156495.1:WP_083710231.1 Length = 589 Score = 126 bits (316), Expect = 1e-33 Identities = 78/223 (34%), Positives = 126/223 (56%), Gaps = 9/223 (4%) Query: 4 FDWSSIVPSLPYLLD-GLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNV 62 F W +LP LL GL TL ++V + V+G + G +LAV +S + W A+ Y ++ Sbjct: 346 FSWDLYAKALPDLLKTGLPNTLILSVVSGVLGTILGMVLAVAGISRSRWLRWPARIYTDI 405 Query: 63 FRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQS 122 FR +P V+V+L L + ++N+ G +P VA ++ AAY EI R+GIQS Sbjct: 406 FRGLPAVVVILVVGLGIGPVVKNLTGNNP-----YWLGAVALALLAAAYIGEIFRSGIQS 460 Query: 123 ISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFR 182 + GQ A+ A+G ++ QSM+L+++PQ R ++P L+ Q I L +D+SLVY L L R Sbjct: 461 VDDGQLEASRAIGFSYRQSMRLVVVPQGVRRVLPALMNQFISLIKDSSLVYFLGLLASQR 520 Query: 183 TASTIGERDGTQ---VEMILFAGFVYFVISLSASLLVSYLKRR 222 +G Q + ++ AG +Y V+++ + LV+Y+ R Sbjct: 521 ELFAVGRDLNAQTGNLSPLVAAGLIYLVLTIPLTHLVNYIDHR 563 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 589 Length adjustment: 29 Effective length of query: 195 Effective length of database: 560 Effective search space: 109200 Effective search space used: 109200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory