Align GluB aka CGL1951, component of Glutamate porter (characterized)
to candidate WP_076477601.1 BW971_RS05925 glutamate ABC transporter substrate-binding protein
Query= TCDB::P48242 (295 letters) >NCBI__GCF_900156495.1:WP_076477601.1 Length = 358 Score = 274 bits (700), Expect = 2e-78 Identities = 158/325 (48%), Positives = 204/325 (62%), Gaps = 39/325 (12%) Query: 9 RIG-AILGATALAGVTLTACGDSSGGDGFLAAIENGSVNVGTKYDQPGLGLRNPDNSMSG 67 RIG A+L + G+ + ACG++ + + +I+ GSV +GTKYDQPGLGLR P+N+ +G Sbjct: 26 RIGLALLLTMTVTGLGIAACGNTDPRN-LIDSIKRGSVILGTKYDQPGLGLREPNNTFTG 84 Query: 68 LDVDVAEYVVNSIADDKGWDHPTIEWRESPSAQRETLIQNGEVDMIAATYSINAGRSESV 127 DV V+ +VVN+IAD HP I WRE+PSAQRETLI NGEVDMIAATYSI A R++ V Sbjct: 85 FDVGVSTFVVNNIADRLKVKHPKITWRETPSAQRETLIDNGEVDMIAATYSITAARAKKV 144 Query: 128 NFGGPYLLTHQALLVRQDDDRIETLEDLDNGLILCSVSGSTPAQKVKDVLPGVQLQEYDT 187 F GPYL+ +Q LLVR+DD+ I TL DLD G LCSV+GST AQ VK+ L GVQLQEYD+ Sbjct: 145 AFAGPYLVNYQGLLVREDDNSISTLTDLDKGKKLCSVTGSTSAQNVKNQLSGVQLQEYDS 204 Query: 188 YSSCVEALSQGNVDALTTDATILFGYS--QQYEGDFRVVEM----------------EKD 229 YSSCVEAL VDALTTD IL G++ Y F++V+M +K Sbjct: 205 YSSCVEALRLKKVDALTTDEVILAGFADFSLYRNKFKIVDMTYPKNACVTASGKKSLKKA 264 Query: 230 GEPFTDEYYGIGLKKDDQEGTDAINAALERMYADG------TFQRLLTENLGEDSVVVEE 283 G PF+ E YGIG+ + + D +N AL+ M G ++R L EN+G+ V + Sbjct: 265 GAPFSTERYGIGMAQQFPQAVDEVNTALDAMLTPGPDGGESAWERTLRENIGDGEVDKLK 324 Query: 284 G-------------TPGDLSFLDAS 295 TPGD +FLDA+ Sbjct: 325 ARASAPESQYSLVPTPGDQAFLDAT 349 Lambda K H 0.312 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 358 Length adjustment: 28 Effective length of query: 267 Effective length of database: 330 Effective search space: 88110 Effective search space used: 88110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory