Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_076482473.1 BW971_RS17350 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_900156495.1:WP_076482473.1 Length = 250 Score = 178 bits (452), Expect = 1e-49 Identities = 100/234 (42%), Positives = 139/234 (59%), Gaps = 10/234 (4%) Query: 18 IPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVE---------GED 68 + L+ L ++ G++ LIG SG+GKST LR +N LE + GR+ V+ G Sbjct: 14 LQVLKGISLEVERGEVTCLIGPSGSGKSTFLRCVNHLESVTAGRLYVDDDLIGYREKGGK 73 Query: 69 VTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLAR 128 + L A+ R+ +GM+FQHFNL +T DNI G RA R +LL + Sbjct: 74 LYELSAKDAAAQRRDIGMVFQHFNLFPHRTALDNIIEAPIQVKGVVRARAVERGKDLLDQ 133 Query: 129 VGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEIN 188 VGL+D A YPAQLSGGQ+QRV IARALA P ++L DE TSALDP+ VL ++ + Sbjct: 134 VGLADKASAYPAQLSGGQQQRVAIARALAMDPKLMLFDEPTSALDPELVGDVLAVMRNLA 193 Query: 189 RELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFV 242 ++ +T+V++THEM R V DQ+ MD G +VE+GD +V PQH T+ F+ Sbjct: 194 KD-GMTMVVVTHEMGFAREVADQLVFMDAGKVVEKGDPREVLNSPQHERTQSFL 246 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 250 Length adjustment: 26 Effective length of query: 309 Effective length of database: 224 Effective search space: 69216 Effective search space used: 69216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory