Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_076477131.1 BW971_RS05160 ATP-binding cassette domain-containing protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_900156495.1:WP_076477131.1 Length = 338 Score = 115 bits (287), Expect = 1e-30 Identities = 72/221 (32%), Positives = 122/221 (55%), Gaps = 4/221 (1%) Query: 4 LKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFL 63 ++V L+ +G +AV + F+V G V L+G NGAGKTT +R +S L+RP +G+I L Sbjct: 12 VEVRGLTKSFGSHRAVDGIDFDVPRGIVCGLLGPNGAGKTTTVRMMSTLLRPDAGRISVL 71 Query: 64 GQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEM-GAFLKKNREENQANLKKVFSR 122 G ++ + V +S + V LT ENLE+ G L + + + + + + Sbjct: 72 GHDV--VSDSTAVRSLISLTGQSASVDNDLTAAENLEIYGRLLGQRGSQARRRARDLIDQ 129 Query: 123 FPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDI 182 F L N+ SGG ++ L + +++ P LL LDEP+ GL P +++DI++ + Sbjct: 130 FG-LSAAGNRPLRHYSGGMRRRLDLAASMIRRPALLFLDEPTTGLDPRTRAQLWDIVRSV 188 Query: 183 QKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKEL 223 GTTV+L Q ++A A++D+ V++ G++V GT + L Sbjct: 189 VAAGTTVVLTTQYLDEADALADQLVVIDNGRVVGQGTPESL 229 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 338 Length adjustment: 26 Effective length of query: 210 Effective length of database: 312 Effective search space: 65520 Effective search space used: 65520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory