Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_076478489.1 BW971_RS08380 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_900156495.1:WP_076478489.1 Length = 270 Score = 113 bits (282), Expect = 4e-30 Identities = 72/214 (33%), Positives = 114/214 (53%), Gaps = 3/214 (1%) Query: 11 VSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFDDKDIT 70 VS Y + L EV L +++G IV L+GANGAGKTTL+ L RA G + D+ Sbjct: 17 VSKSYRDVTVLREVDLRVDRGRIVALLGANGAGKTTLVRILATLTRADGGEAMVAGFDVA 76 Query: 71 DWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWVYELFPRLHER 130 D A +REA+++ + V +T ENL + + + + E F L + Sbjct: 77 D--DAARVREAISLTGQFAAVDEVLTGRENLVLIARLRHVPHPTDAARTLLERFSLL-DA 133 Query: 131 RIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQLREQGMTI 190 ++AGT SGG ++ L I +L+ +P ++ DEP+ GL P +++D I +L G+++ Sbjct: 134 ADRKAGTYSGGMRRRLDIAMSLIGDPEVVFFDEPTTGLDPQARIEVWDAISRLAGSGVSV 193 Query: 191 FLVEQNANQALKLADRGYVLENGHVVLSDTGDAL 224 L Q ++A LADR +L +G ++ DT D L Sbjct: 194 LLTTQYLDEAEHLADRIAILHHGRIIADDTFDNL 227 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 270 Length adjustment: 24 Effective length of query: 213 Effective length of database: 246 Effective search space: 52398 Effective search space used: 52398 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory