Align crotonase (EC 4.2.1.150) (characterized)
to candidate WP_076480233.1 BW971_RS12060 enoyl-CoA hydratase
Query= metacyc::MONOMER-13469 (259 letters) >NCBI__GCF_900156495.1:WP_076480233.1 Length = 262 Score = 195 bits (496), Expect = 7e-55 Identities = 108/237 (45%), Positives = 146/237 (61%), Gaps = 1/237 (0%) Query: 14 VASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSGKAFVAGADIAEMKDL 73 V +I LNRP +NALN +E+ + D++ AV++ G K AGADI EM D+ Sbjct: 16 VGTILLNRPP-MNALNRQLQRELLEVAREATVRDDIRAVVLYGGPKVLAAGADIKEMNDM 74 Query: 74 TAVEGRKFSVLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCDIRIASSKAKFGQPE 133 + E K + + L + KP +AAI G+ALGGG E++L+ D RIA AK G PE Sbjct: 75 SFAEMSKLAGDLQEGLGALSTIPKPTVAAITGYALGGGLEIALAADRRIAGDNAKLGVPE 134 Query: 134 VGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVNKVVEPDKLLEEAKA 193 + LG+ PG GGTQRLAR IG AK++++TG+ + AEEAL IGLV++VV PD + A A Sbjct: 135 ILLGVIPGGGGTQRLARLIGPSRAKDMVFTGRFVGAEEALSIGLVDEVVAPDDVYTAAVA 194 Query: 194 LVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAEVFGECFATEDRVEGMTAFVE 250 A +A+ KAAI+QGL D+ TG+ E +VF FATEDR GMT+F+E Sbjct: 195 WAAQFSSAAAVALAGAKAAIDQGLDTDLGTGLKIERQVFASLFATEDRAIGMTSFIE 251 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 262 Length adjustment: 25 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory