Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_076482575.1 BW971_RS18685 aldehyde dehydrogenase family protein
Query= BRENDA::P77674 (474 letters) >NCBI__GCF_900156495.1:WP_076482575.1 Length = 507 Score = 301 bits (772), Expect = 3e-86 Identities = 180/472 (38%), Positives = 257/472 (54%), Gaps = 17/472 (3%) Query: 12 VSGEGEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTPKVRAECLLKLA 71 V G+ + P +P G EIA ++AE +D A+ AA A WG+T P R+ LL++A Sbjct: 32 VKGQYFENP--SPINGRTFCEIARSTAEDIDLALDAAHKAAPAWGKTAPAERSLVLLRIA 89 Query: 72 DVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNGLAAGEYLEGHT 131 D IEEN + A ES + GK + +IP VD R+FAGA R G + E E Sbjct: 90 DRIEENLEKIAVAESWDNGKAVRETLAADIPLAVDHLRYFAGALRAQQG-SISEIDEDTV 148 Query: 132 SMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLAELAKDI 191 + +PLGVV I PWN+P++MA WK+APALAAGN +VLKP+E TP + L L L D+ Sbjct: 149 AYHFHEPLGVVGQIIPWNFPILMAIWKIAPALAAGNAIVLKPAEQTPASILYLISLIGDL 208 Query: 192 FPAGVINILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASSIKRTHMELGGKA 251 P GV+N++ G G G PL ++R ++ TG TG I+ + + +I +ELGGK+ Sbjct: 209 LPEGVLNVVNGFGVEAGKPLASSNRIRKIAFTGETTTGRLIMQYASENIIPVTLELGGKS 268 Query: 252 PVIVFDDADI------EAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVA 305 P I FDD I + +EG F N G+ CT R Q+GIYD +E V Sbjct: 269 PNIFFDDVLIADDGFRQRALEGFAMFA-LNQGEVCTCPSRALIQEGIYDDFIELGVERVK 327 Query: 306 TLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEKRK-----GNGYYY 360 +K G P D T +G +S E++ + K G +V+TGGE + GYY Sbjct: 328 HIKQGNPLDTETMMGAQASNDQFEKITSYLSIGKEEG-AEVLTGGEILELDGDLAGGYYI 386 Query: 361 APTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHR 420 PT+ AG+ I Q+E+FGPV+SV F + + ++ AND+ YGL + VW++D A+R Sbjct: 387 KPTVFAGS-NKMRIFQEEIFGPVLSVAKFADYNEAMSIANDTLYGLGAGVWSRDGATAYR 445 Query: 421 VSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMV 472 +Q G W NT+ + GG K SG G++ L LE Y ++++V Sbjct: 446 AGREIQAGRVWTNTYHDYPAHAAFGGYKQSGIGRENHLVMLEHYQQTKNLLV 497 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 574 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 507 Length adjustment: 34 Effective length of query: 440 Effective length of database: 473 Effective search space: 208120 Effective search space used: 208120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory