Align Peroxisomal multifunctional enzyme A; MFE-A; MFE-1; EC 1.1.1.35 (characterized)
to candidate WP_076478062.1 BW971_RS07650 SDR family NAD(P)-dependent oxidoreductase
Query= SwissProt::Q9NKW1 (441 letters) >NCBI__GCF_900156495.1:WP_076478062.1 Length = 289 Score = 165 bits (418), Expect = 1e-45 Identities = 109/261 (41%), Positives = 145/261 (55%), Gaps = 20/261 (7%) Query: 5 FKDKVVIVTGAGGGIGKVYALEFAKRGAKVVVNDLGGSHTGQGSSSKAADKVVEEIKAAG 64 F V IVTGAG GIG+ +AL A GA VVVNDLGG++ G G+ + A VV+EI AAG Sbjct: 4 FDGTVAIVTGAGRGIGREHALLLAAEGASVVVNDLGGANDGTGTDAGPAQDVVDEIVAAG 63 Query: 65 GTAVANYDSVED---GEKIVQTAMDSFGGVDILINNAGILRDVSFGKMTDGDWDLVYRVH 121 G AVAN D+V ++V A+ FG +DILINNAGILRD +T+ WD V VH Sbjct: 64 GRAVANTDNVAQWAGAGRLVDQAVAEFGRLDILINNAGILRDAFIAGITEDQWDAVIAVH 123 Query: 122 AKG-AYKLSRAA--W---NHMREKNFGRIIMTSSAAGLY-GNFGQANYGSMKMALVGLSN 174 KG A L AA W + E ++ T+SA+G + N GQANYG+ K + L+ Sbjct: 124 LKGHAACLHHAAAYWKARSKAGEDVSAAVVNTASASGTFMPNAGQANYGAAKAGIAALTQ 183 Query: 175 TLAQEGKSKNIHCNTIAPIAASRLTESV----------MPPEILEQMKPDYIVPLVLYLC 224 A+E + + N IAPIA +RLT + +P + P I P+V YL Sbjct: 184 VAAEELERYGVRVNAIAPIARTRLTLATPGMSALFAEEVPEGEFDAFSPANIAPVVAYLA 243 Query: 225 HQDTTETGGVFEVGAGWVSKV 245 ++ TG VF V G +S++ Sbjct: 244 DPNSKLTGKVFAVQGGAISEL 264 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 289 Length adjustment: 29 Effective length of query: 412 Effective length of database: 260 Effective search space: 107120 Effective search space used: 107120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory