Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_076476008.1 BW971_RS02060 4-aminobutyrate--2-oxoglutarate transaminase
Query= BRENDA::Q88RB9 (425 letters) >NCBI__GCF_900156495.1:WP_076476008.1 Length = 452 Score = 347 bits (889), Expect = e-100 Identities = 180/424 (42%), Positives = 252/424 (59%), Gaps = 3/424 (0%) Query: 5 NESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLHPKVV 64 + +L +RR AAV GVG + PI+ A ++DV+G LID GIAV G +P V Sbjct: 24 SSALAKRRAAAVAAGVGSVVPIYAADADGGIIVDVDGNSLIDLGSGIAVTGVGASNPAVA 83 Query: 65 AAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVTTGSEAVENAVKIAR 124 AV Q +HTCF V YE YV + EK+N+L PGD +K+++L +G+EAVENAVK+AR Sbjct: 84 DAVAAQAHHFTHTCFMVTPYEGYVAVAEKLNELTPGDHEKRSVLFNSGAEAVENAVKVAR 143 Query: 125 AATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGISVDDA 184 ATGR ++AF YHGRT +T+ LT K PY G I+R D Sbjct: 144 LATGRDAIVAFDHAYHGRTNLTMALTAKTQPYKYNFGPFAPEIYRMPMSYPYRDDLGTDG 203 Query: 185 IASVERIFKN---DAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIADE 241 +++ +R + +A +++EP+QGEGGF+ + L +G++ IADE Sbjct: 204 VSAAKRAIRQIETQIGGEAVAGLLIEPIQGEGGFIVPAPGFLTTLAEWARDNGVVFIADE 263 Query: 242 VQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYAG 301 VQ G RTGT+FA E G+ PD+ T AK IAGG PL+ + G+A+ +D + PGGLGGTY G Sbjct: 264 VQAGFCRTGTWFASEAEGIVPDIVTTAKGIAGGMPLSAITGRADLLDKVHPGGLGGTYGG 323 Query: 302 SPIACAAALAVIEVFEEEKLLDRSKAVGERLTAGLREIQKKYPIIGDVRGLGSMIAVEVF 361 +P+ACAAALA I EE L R+ + E LR + +IGDVRG G+M+A+E+ Sbjct: 324 NPVACAAALATIAEMEELDLNARAHHIEEIALPRLRTLADDLDVIGDVRGRGAMLAIEIV 383 Query: 362 EKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEECF 421 E GT TP A +V A A E G+++L GT+GNV+R+L PL +D L G+ ++E+ Sbjct: 384 EPGTDTPAPALAKKVAAAALEAGVVILVTGTFGNVIRLLPPLVIDDETLVDGIDVLEQSL 443 Query: 422 AEIA 425 +A Sbjct: 444 HSVA 447 Lambda K H 0.320 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 589 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 452 Length adjustment: 32 Effective length of query: 393 Effective length of database: 420 Effective search space: 165060 Effective search space used: 165060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory