Align SmoF, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_076478911.1 BW971_RS08980 sugar ABC transporter permease
Query= TCDB::O30832 (290 letters) >NCBI__GCF_900156495.1:WP_076478911.1 Length = 318 Score = 220 bits (560), Expect = 4e-62 Identities = 108/272 (39%), Positives = 171/272 (62%), Gaps = 1/272 (0%) Query: 16 PAVILLFLWMIVPLSMTLYFSFLRYNLLMPGMESFTGWDNYYYFLTDPAFSAALTNTILL 75 PA+I + + +P +TLY+S +NL+ PG F +NY D F + NT+LL Sbjct: 40 PALIFMIIVTQIPFLVTLYYSTQSWNLVRPGSRKFNWLNNYVEVFKDSQFWSVTGNTVLL 99 Query: 76 VVGVLLITVVGGVLLALLLDQPFWGQGIVRVLVIAPFFVMPTVSALVWKNMFMNPVNGMF 135 +VG ++I+V+ G++ ALLLD+ F G+ +VR L+I PF V P SAL+WK ++P NG+ Sbjct: 100 IVGTVVISVILGLIFALLLDRKFVGRSVVRTLLITPFLVTPVASALLWKTSLLSPTNGLV 159 Query: 136 AHIARGLGLPPFDFLSQAPLASIIGIVAWQWLPFATLILLTALQSLDREQMEAAEMDGAS 195 R LGL D+LS+ PLAS++ + WQW PF L++L LQS+ R+ EAA +DGA+ Sbjct: 160 NWALRPLGLD-VDWLSEFPLASVMAELVWQWTPFMMLLILAGLQSMPRDIQEAARVDGAT 218 Query: 196 ALDRFIHITVPHLTRAITVVVLIQTIFLLGVFAEILVTTNGGPGTASTNITYLVYAQSLL 255 + F +T+PHL R I + ++ I+L+ F + + T+GGPG AS+N+ + +Y ++ L Sbjct: 219 SFRLFRELTLPHLRRFIELGTVLGAIYLVNTFDAVYMMTSGGPGVASSNLPFYIYQRAFL 278 Query: 256 NYDVGGGSAGGIVAVVLANIVAIFLMRMIGKN 287 +D+G +A G+V V+ +VA +R+I K+ Sbjct: 279 GFDIGQAAAMGVVTVIGTIVVATLALRLIFKS 310 Lambda K H 0.329 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 318 Length adjustment: 27 Effective length of query: 263 Effective length of database: 291 Effective search space: 76533 Effective search space used: 76533 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory