Align Fructokinase-1; Fructokinase I; OsFKI; EC 2.7.1.4 (characterized)
to candidate WP_076480615.1 BW971_RS14065 hypothetical protein
Query= SwissProt::Q0JGZ6 (323 letters) >NCBI__GCF_900156495.1:WP_076480615.1 Length = 294 Score = 93.2 bits (230), Expect = 7e-24 Identities = 92/284 (32%), Positives = 128/284 (45%), Gaps = 41/284 (14%) Query: 36 APGGAPANVAIAVARLGGGAAFVGKLGDDEFGRMLAAILRDNGVDDGGVVFDAGARTALA 95 A GG AN AIA AR G +G +GDD+F + LRD G+D + G T LA Sbjct: 42 AQGGKGANQAIAAARAGAAVTLIGAVGDDDFAEVPVGALRDAGIDVDSLRRTTGP-TGLA 100 Query: 96 FVTLRADGEREFMFYRNPSADML-LTHAELNVELIKRAAVFHYGSISLIAEPCRSAHLRA 154 VT+ A GE + +A + L +EL+ AV +SL E S L A Sbjct: 101 TVTVAASGENSIVVIPGANAHLTELRRSELD-------AVATADVLSLQLEIPMSGVLAA 153 Query: 155 MEIAKEAGALLSYDPNLREALWPSREEARTKILSIWDQADIVKVSEVELEFLTGIDSVED 214 E A G + +P+ L PS S+ + DI+ V+ E L +VE Sbjct: 154 AEHAHAHGTTVVLNPSPVTEL-PS---------SLLEVVDILVVNRGEAARL----AVET 199 Query: 215 DVVMKLWRPTMKLLLVTLGDQGCK--YYARDFRGAVPSYKVQQVDTTGAGDAFVGALLRR 272 P +++ TLG G + + A D ++ + V VDTTGAGD F G L R Sbjct: 200 -------LPPRMVVVTTLGSDGVRVIHAASDTDASIAAPAVDTVDTTGAGDVFAGTLCAR 252 Query: 273 IVQDPSSLQDQKKLEEAIKFANACGAITATKKGAIPSLPTEVEV 316 + P L D A+ FANA A++ T+ GA S P+ +V Sbjct: 253 L---PDGLVD------AVAFANAAAALSTTRPGAGSSAPSAQDV 287 Lambda K H 0.320 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 294 Length adjustment: 27 Effective length of query: 296 Effective length of database: 267 Effective search space: 79032 Effective search space used: 79032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory