Align Putative aldehyde dehydrogenase FUS7; Fusarin biosynthesis protein 7; EC 1.2.1.3 (characterized)
to candidate WP_076476644.1 BW971_RS03485 aldehyde dehydrogenase family protein
Query= SwissProt::S0ENH1 (461 letters) >NCBI__GCF_900156495.1:WP_076476644.1 Length = 480 Score = 360 bits (923), Expect = e-104 Identities = 187/464 (40%), Positives = 273/464 (58%), Gaps = 10/464 (2%) Query: 6 FYNIITGQPRSARETTSGVNPLDRSSLWPAPVATGNDVEEAVRSAQEAFPAWSEKTYKQR 65 + N+I G+ RS+ E+ NP PVAT D+++AV +A A+P WS + +R Sbjct: 9 YANVINGETRSSAESAPVYNPATGQVFAEVPVATRADLDDAVTAAAAAYPGWSATSAAER 68 Query: 66 TELLEKFADLYLVHANEFCQLIATECGRTAGNAAIEVYVAAQWLRYPSKYEIPEEVTEDE 125 + D HA EF L+ E G+ A EVY + W R +K ++P+EV ED Sbjct: 69 AAAVSAIGDRLEAHAEEFITLLTAEQGKPRSMAEWEVYGSVAWFREIAKQQLPDEVVEDT 128 Query: 126 KKTSIVT-HEPLGVVAAICPWNFPLMLALGKIAPALATGNCVILKPSPFTPYSSLKLVEL 184 + +++ + PLGVV AI PWNFP++LA+ KIAPAL TGN +I+KPSPFTP LKLVEL Sbjct: 129 PERRVISRYTPLGVVGAIVPWNFPILLAVWKIAPALVTGNTIIVKPSPFTPLCDLKLVEL 188 Query: 185 AQQVFPPSVLQVLHGHDDLGPMLVKHPRIQKITFTGSTTTGKQILRDAAETMKRVTLETA 244 Q + PP VL L G DDLG + HP I KI FTGST TG+ ++ AA T+KRVTLE Sbjct: 189 VQDLLPPGVLSALSGDDDLGKWMTVHPGIAKIAFTGSTETGRHVMASAAGTLKRVTLELG 248 Query: 245 GNNASIILPDVNIEAVIPQLAGGLWFNAGQVCIATRRMYIHQDIFDEAVAQLAEASKDLA 304 GN+ +I+L DV+ + V PQ+ + N Q C A +R+YIH D++D +L E ++ + Sbjct: 249 GNDPAIVLRDVDPQKVAPQIFWAAFQNNAQFCNAAKRIYIHDDVYDAVRDELVEYARSVV 308 Query: 305 SG--------MEPIQNEMQLVRLQQALSDANAAGCELLSLGKTEA-AEGFFIQPTILKSP 355 G + PIQN QL ++ + D G G+ + +EG+F+ T++ +P Sbjct: 309 VGDGSHPDTQLGPIQNRPQLAKVTEYFDDCRKNGYTFALGGEIDTESEGWFVPVTLVDNP 368 Query: 356 PPDADVVQQENFGPIVSCIKFSSLDEAISLANNSDTGLAASVWSSDVSAARRVAAKLEVG 415 P D+ +V +E FGPI+ +K+S D+ ++ AN++ GL A+VW D+ A R+ ++E G Sbjct: 369 PEDSRLVAEEPFGPILPLLKWSEEDDVVARANDTVWGLGATVWGDDLEAVERIGRRIEAG 428 Query: 416 NVYINGPPQPDPYVPFGGHKQSGLGVEYGLPGLLSFCQTKSTYL 459 V++N Q P+ FGGHKQSG+G E L GL + ++ L Sbjct: 429 TVWLNEVHQYSPHQVFGGHKQSGIGAENSLHGLAEYTNYQTVCL 472 Lambda K H 0.316 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 529 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 480 Length adjustment: 33 Effective length of query: 428 Effective length of database: 447 Effective search space: 191316 Effective search space used: 191316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory