Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate WP_079650853.1 B5X82_RS24130 acyl-CoA dehydrogenase
Query= SwissProt::Q2LQN9 (414 letters) >NCBI__GCF_900167915.1:WP_079650853.1 Length = 381 Score = 254 bits (650), Expect = 2e-72 Identities = 146/376 (38%), Positives = 209/376 (55%), Gaps = 2/376 (0%) Query: 36 ELTEEQKLLMEMVRNLAVREIAPRAIEIDENHSFPVHARDLFADLGLLSPLVPVEYGGTG 95 ELTE+Q+ + EM + I P A E DE H FP A LG V E GG G Sbjct: 6 ELTEDQRAIQEMAQKFTADAITPHAAEWDEKHIFPRETIQAAAALGFGGIYVSEEAGGIG 65 Query: 96 MDITTFAMVLEEIGKVCASTALMLLAQADGMLSIILDGSPALKEKYLPRFGEKSTLMTAF 155 + A+++E + C ST+ + I GS LK +YLP M ++ Sbjct: 66 LGRLEAALIMEAMAYGCPSTSAFISIHNMAAWMIDRFGSDDLKGRYLPDM-IACQRMGSY 124 Query: 156 AATEPGAGSDLLAMKTRAVKKGDKYVINGQKCFITNGSVADILTVWAYTDPSKGAKGMST 215 TEPG+GSD A+KTRAV+ GD YV++G K FI+ G ++ V T G KG+S Sbjct: 125 CLTEPGSGSDAAALKTRAVRDGDHYVVSGSKAFISGGGENEVYVVMVRTGED-GPKGISC 183 Query: 216 FVVERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLVGEEGKGFAYLMGALSINR 275 V+++ PG+ +G EKK+G P +++ F+ + VP N VG EG+GF M L R Sbjct: 184 LVIDKDMPGVSFGAQEKKLGWHSQPTAQVNFDAVRVPVANRVGGEGEGFRIAMMGLDGGR 243 Query: 276 VFCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAARLLVRKAT 335 + + ++G AQ L+ A+ +T+ER+QFG+PIA IQF +ADM TE++AAR+L+ A Sbjct: 244 LNIGACSLGGAQRCLDEAVSYTKERKQFGQPIADFQSIQFTLADMETELQAARMLLYAAA 303 Query: 336 TLLDAKDKRGPLIGGMAKTFASDTAMKVTTDAVQVMGGSGYMQEYQVERMMREAKLTQIY 395 + A MAK FA+DT V A+Q+ GG GY+Q+Y +ER R+ ++ +I Sbjct: 304 AKVTANAPDKTRFAAMAKRFATDTGSAVVDRALQLHGGYGYLQDYPIERFWRDLRVHRIL 363 Query: 396 TGTNQITRMVTGRSLL 411 GTN+I RM+T R LL Sbjct: 364 EGTNEIMRMITSRELL 379 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 381 Length adjustment: 31 Effective length of query: 383 Effective length of database: 350 Effective search space: 134050 Effective search space used: 134050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory