Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate WP_079646480.1 B5X82_RS02725 CoA transferase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >NCBI__GCF_900167915.1:WP_079646480.1 Length = 409 Score = 398 bits (1023), Expect = e-115 Identities = 201/404 (49%), Positives = 268/404 (66%), Gaps = 1/404 (0%) Query: 4 LSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENTTEA 63 L ++RVLDL+RVLAGP+A Q+LAD+GADVIK+ERP GDD R +G P+L+DA G T E Sbjct: 6 LENIRVLDLTRVLAGPFASQVLADMGADVIKIERPVVGDDARIFGEPYLRDAEGNRTREN 65 Query: 64 AYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKAINP 123 A+Y+S NRNK+SV ++ P GQ L+R+L D+++EN+KVG L YGLDY+SLKA NP Sbjct: 66 AFYMSVNRNKRSVALNIASPRGQALIRKLVLSCDVVMENYKVGDLKRYGLDYESLKATNP 125 Query: 124 QLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDILTG 183 ++IYCS+TG+GQTGP A + GYD + QG GLMS+TG P+G GAGP+KVG ++ D+ TG Sbjct: 126 RIIYCSVTGYGQTGPLAAKPGYDAVFQGECGLMSVTGVPDGKPGAGPMKVGPSIIDLFTG 185 Query: 184 LYSTAAILAALAHRDHVGG-GQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHPNI 242 L A+LAAL HRD GG GQ+ID+ALLD ++ L++ A YLT+G P R G Sbjct: 186 LNVANAVLAALYHRDAAGGEGQYIDVALLDCGISALSHYAQIYLTSGEVPVRRGTQGNGG 245 Query: 243 VPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLIRQ 302 +P F +DG ++T GND Q+ + G P+ A PRF TN +RV +R + + Sbjct: 246 MPTSKFACSDGAIMITSGNDKQYVALCDAVGHPELATHPRFHTNVLRVQHRDEITEVFDA 305 Query: 303 ATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVASPI 362 T A W+ +L +AG+P GPINDL QVF PQ Q RG+ + PH L + + SP+ Sbjct: 306 IFATNTVAYWLEKLGEAGIPSGPINDLEQVFDYPQAQHRGMRVRAPHPLKPDLDLIRSPL 365 Query: 363 RLSETPVEYRNAPPLLGEHTLEVLQRVLGLDEAAVMAFREAGVL 406 S TP+ APP+LGEHT VL LGL EA + A + GV+ Sbjct: 366 NFSATPITDYRAPPMLGEHTRAVLAGELGLSEAEIDALGDEGVI 409 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 409 Length adjustment: 31 Effective length of query: 375 Effective length of database: 378 Effective search space: 141750 Effective search space used: 141750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory