Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_079650634.1 B5X82_RS22845 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_900167915.1:WP_079650634.1 Length = 252 Score = 151 bits (381), Expect = 2e-41 Identities = 85/205 (41%), Positives = 116/205 (56%), Gaps = 3/205 (1%) Query: 11 KRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIGGRKVNDL 70 K Y V+ + L ++ F+ALVG SG GK+T L+ I L E+ GAI I GR + Sbjct: 9 KHYAGRRVLDDVSLTIERGSFVALVGASGAGKTTLLKTINRLVEIDTGAIAIEGRDIAAQ 68 Query: 71 PPRA--RNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDL-AHLL 127 P R I VFQ L+PHM+VAEN+ ++ G P EE RVAE ++ L A L Sbjct: 69 PVAELRRRIGYVFQGIGLFPHMSVAENVALVPRLQGMPREERAARVAELLDLVALPADLA 128 Query: 128 ERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARMQATM 187 R P+QLSGGQ QRV RA+ +P + L DEP LD R ++ + LH M T Sbjct: 129 ARHPAQLSGGQAQRVGFARALAARPAIMLMDEPFGALDPVTRDELGAAYRALHDVMGLTS 188 Query: 188 IYVTHDQVEAMTLSDRIVIMRDGHI 212 + VTHD EA+ L+DR++++ +G I Sbjct: 189 LIVTHDMAEALLLADRVIVIGEGRI 213 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 252 Length adjustment: 27 Effective length of query: 338 Effective length of database: 225 Effective search space: 76050 Effective search space used: 76050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory