Align Short-chain dehydrogenase (characterized, see rationale)
to candidate WP_079650740.1 B5X82_RS23155 SDR family oxidoreductase
Query= uniprot:A0A2E7P8M8 (258 letters) >NCBI__GCF_900167915.1:WP_079650740.1 Length = 251 Score = 107 bits (268), Expect = 2e-28 Identities = 82/261 (31%), Positives = 129/261 (49%), Gaps = 27/261 (10%) Query: 1 MDLNLQDKVVIVTGGASGIGGAISLQLAAEGAIPVVFARSEPDPQFWARLTGLQPRAALF 60 M + KV+IVTG A+G+G AI+ +LA EGA V T + + Sbjct: 1 MSGRVSGKVIIVTGAAAGLGAAIAARLAEEGATVV--------------RTDIMGGDGVV 46 Query: 61 QLELQDEARCGEAVAETVRRFGRLDGLVNNAGVNDSVGLDAGRNEFVASLER----NLIH 116 + ++ DE + +AE V GRLDGLVNNAG+ D G R N+ Sbjct: 47 RQDVTDEGQWQALIAEVVGTHGRLDGLVNNAGIADGKGPPDPEGALAEDWRRIYTVNVEG 106 Query: 117 YYVMAHYCVPHLKAT-RGAILNVSSKTALTGQGNTSGYCASKGAQLSLTREWAAALRDDG 175 ++ + +P + A GAI+N+SS AL S Y ASK A + TR A + G Sbjct: 107 VFLGCKHAIPAIAAAGGGAIVNMSSIGALVPTPFLSAYGASKAAVMQFTRSVALHCCEQG 166 Query: 176 --VRVNALIPAEVMTPLYEKWIATFE-----NPQEKLDAITSKIPLGKRFTTSEEMADMA 228 +R N++ P +V TP++++ IA + ++ A SK+P+ K++ + ++A+ Sbjct: 167 HAIRCNSVHPGQVRTPMHDELIARTAAEHGLDAEQAAQAFLSKVPM-KKWQEAVDIANGV 225 Query: 229 VFLLSGRSSHTTGQWVFVDGG 249 +FL+S + TG + VDGG Sbjct: 226 LFLMSDEARFVTGTSLVVDGG 246 Lambda K H 0.318 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 251 Length adjustment: 24 Effective length of query: 234 Effective length of database: 227 Effective search space: 53118 Effective search space used: 53118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory