Align SDR family oxidoreductase (characterized, see rationale)
to candidate WP_079649919.1 B5X82_RS19900 glucose 1-dehydrogenase
Query= uniprot:A0A4P7ABK7 (254 letters) >NCBI__GCF_900167915.1:WP_079649919.1 Length = 248 Score = 149 bits (377), Expect = 4e-41 Identities = 99/258 (38%), Positives = 146/258 (56%), Gaps = 27/258 (10%) Query: 6 GRLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLL--DV 63 GRLAGK +IT AA+G+G + FAREGAR+I TD++ + LA G + DV Sbjct: 2 GRLAGKVAIITGAARGMGESHARTFAREGARLILTDLNVEKGQALAREIGEAAIFVDHDV 61 Query: 64 TDDD----AIKALVAKVGTVDVLFNCAGYVA-AGNILECDDKAWDFSFNLNAKAMFHTIR 118 T D I A V++ GT+D+L N AG + N ++ D + +N ++F+ ++ Sbjct: 62 TKPDQWAAVIDAAVSRFGTIDILVNNAGILGPMANTVDLTDAGYQQVCAINQHSVFYGMQ 121 Query: 119 AVLPGMLAKKAGSIVNIASAASSVKGVANRF-----AYGASKAAVVGLTKSVAADFVSQG 173 AVLP M+ GSIVNI SS+ G+A + AY ASK AV G+TK+ A ++ Sbjct: 122 AVLPTMVKANRGSIVNI----SSIAGMAANYGFPSLAYVASKFAVRGMTKATAMEYGRYN 177 Query: 174 IRCNAICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYL 233 IR N++ PG I++P + + + DEV +A+ P+GRI EV+ L L+L Sbjct: 178 IRVNSVHPGFIQTPMMVE-----------ATDEVGGEALAQIPLGRIADPVEVSNLVLFL 226 Query: 234 ASDESNFTTGSIHMIDGG 251 ASDES++ T S H++D G Sbjct: 227 ASDESSYITASEHLVDAG 244 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 248 Length adjustment: 24 Effective length of query: 230 Effective length of database: 224 Effective search space: 51520 Effective search space used: 51520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory