Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_079650634.1 B5X82_RS22845 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_900167915.1:WP_079650634.1 Length = 252 Score = 144 bits (362), Expect = 2e-39 Identities = 86/244 (35%), Positives = 134/244 (54%), Gaps = 15/244 (6%) Query: 23 KQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQILLDGESIGYH 82 K Y VL V LT++RG+ V L+G+SG+GKTTLL+ +N L E G I ++G I Sbjct: 9 KHYAGRRVLDDVSLTIERGSFVALVGASGAGKTTLLKTINRLVEIDTGAIAIEGRDI--- 65 Query: 83 EVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLHKDEAVVLAE 142 + + +A+ R G FQ LFPH++ +NV L + +++ + ++E Sbjct: 66 ---------AAQPVAELRRRIGYVFQGIGLFPHMSVAENVAL-VPRLQGMPREERAARVA 115 Query: 143 KWLERVGL-LERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPELVGEVLS 201 + L+ V L + +P QLSGGQ QRV ARA+A P++ML DE ALDP E+ + Sbjct: 116 ELLDLVALPADLAARHPAQLSGGQAQRVGFARALAARPAIMLMDEPFGALDPVTRDELGA 175 Query: 202 VIKGLAE-DGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSPRLAEFL 260 + L + G+T L+VTH+M A ++D+++ + +GRI PP+ L PR+ + Sbjct: 176 AYRALHDVMGLTSLIVTHDMAEALLLADRVIVIGEGRILADQPPRALIHGAGDPRIEAMI 235 Query: 261 KNTR 264 R Sbjct: 236 AVAR 239 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 252 Length adjustment: 24 Effective length of query: 241 Effective length of database: 228 Effective search space: 54948 Effective search space used: 54948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory