Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_139385112.1 B5X82_RS14905 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_900167915.1:WP_139385112.1 Length = 241 Score = 142 bits (359), Expect = 7e-39 Identities = 87/242 (35%), Positives = 134/242 (55%), Gaps = 14/242 (5%) Query: 5 LDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEGE 64 + +AG+ K +G LR V + VA GE +++ GPSG GKSTL+ I GL+ EG Sbjct: 2 IHMAGVGKWYG----DYHALRNVSLDVARGERIVICGPSGSGKSTLIRCINGLETHDEGV 57 Query: 65 IRIGGKNVVGMPPRD------RDIAMVFQSYALYPTLSVADNIGFA-LEMRKMPKPERQK 117 IRIG V P R + MVFQ + L+P L++ +N A +++R + + + Sbjct: 58 IRIGEDEV--RPDRRVLQRIRARVGMVFQDFNLFPHLTILENCALAPMKVRGLARDAAEA 115 Query: 118 RIDEVAAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEM 177 E+ ++I+ D+ P+QLSGGQ+QR A+ RALA QP++ LFDEP S LDA++ E+ Sbjct: 116 LARELLERVRIADQADKYPAQLSGGQQQRTAIARALAMQPEIILFDEPTSALDAEMVKEV 175 Query: 178 RAEIKRLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVAT 237 +I + GIT + VTH+ A + RI M G + + G+P + + P + Sbjct: 176 -LDIMKALATEGITMLCVTHEMGFAREVADRIIFMDAGQIVETGSPHDFFTAPCHERTRA 234 Query: 238 FI 239 F+ Sbjct: 235 FL 236 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 241 Length adjustment: 26 Effective length of query: 329 Effective length of database: 215 Effective search space: 70735 Effective search space used: 70735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory