Align 3-hydroxypropanonate dehydrogenase (EC 1.1.1.59) (characterized)
to candidate WP_139385133.1 B5X82_RS18185 3-hydroxyisobutyrate dehydrogenase
Query= metacyc::MONOMER-18957 (354 letters) >NCBI__GCF_900167915.1:WP_139385133.1 Length = 296 Score = 127 bits (319), Expect = 4e-34 Identities = 95/320 (29%), Positives = 155/320 (48%), Gaps = 36/320 (11%) Query: 20 GFIGLGLMGQHMARHVYNQLEPSDKLYVYDVDPKHTTQFLTEVTSQTPQNAPLLTPLNSL 79 GFIGLG MG MA N + + +D+ + + + Sbjct: 5 GFIGLGNMGGGMAA---NLAKKGHDVRAFDLSKEAVDRAVAAGCVAAGS----------- 50 Query: 80 KDFTTEVDSQLDFIVTMVPEGKHVKSVVSELVGHYKSTGNYDPSIKTTFLDSSTIDIPTS 139 +E +++VTM+P G+HV++V Y++ +D STID+ ++ Sbjct: 51 ---ASEAVKDAEYVVTMLPAGQHVRAV-------YENDVFGSAPASALLMDCSTIDVASA 100 Query: 140 RDVHQLVKSSIPEFDFIDTPVSGGVAGARKGTLSFML--SRETHDDIDPSLTALLSKMGI 197 R V+ ++ +D PVSGG+A A GTL+FM+ S E +P +L+ MG Sbjct: 101 RAVN--AAAAAQGLAMVDAPVSGGIAAANGGTLTFMVGGSAEHFARAEP----VLALMGK 154 Query: 198 NIFPCGATHGTGLAAKLANNYLLAITNIAAADSFQLAESFGLNLQNYAKLVAVSTGKSWA 257 + G G+G AAK+ NN +L T +A ++F LA GL+LQ + + + ++G+SW+ Sbjct: 155 AVIHAGGA-GSGQAAKIVNNMILGATMVATCEAFALASKLGLDLQTFYDISSKASGQSWS 213 Query: 258 SVDNCPIPGVYPDNNLPSDVNYEGGFITKLTRKDVVLATESAKFNNRFLMLGDIGRHWYD 317 CP+PGV P + P+D +Y+GGF L KD+ LA E+A+ + +G Y Sbjct: 214 MTSYCPVPGVGPQS--PADNDYQGGFAAGLMLKDLKLAVEAAQGVGASVPMGGHAESLY- 270 Query: 318 KACEREDIANRDLSVLFEWL 337 +A A +D S + + L Sbjct: 271 QAFANLGGAGKDFSAIIKLL 290 Lambda K H 0.317 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 296 Length adjustment: 28 Effective length of query: 326 Effective length of database: 268 Effective search space: 87368 Effective search space used: 87368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory