Align Enoyl-CoA-hydratase; EC 4.2.1.17 (characterized)
to candidate WP_079649920.1 B5X82_RS19905 crotonase
Query= SwissProt::G4V4T7 (265 letters) >NCBI__GCF_900167915.1:WP_079649920.1 Length = 256 Score = 194 bits (494), Expect = 1e-54 Identities = 113/262 (43%), Positives = 153/262 (58%), Gaps = 11/262 (4%) Query: 6 VRYEKKDHVAYVTMDRPAVLNAMDRRMHEELAGIWDDVEADDDVRAVVLTGAGDRAFSVG 65 V+++++ HVA V ++RPA LNA+D M LA WD ++ D D+ VL+G GDRAF G Sbjct: 4 VQFQRRGHVADVRLNRPAALNAIDDAMDRALADAWDRIDEDPDIWVAVLSGNGDRAFCAG 63 Query: 66 QDLKERARLNESGVAPTTFGSG--GQAGHPRLTDRFTLSKPVVARVRGYALGGGFELVLA 123 D+ +G +FG G G G R L KP++ V G+ LG GFEL + Sbjct: 64 GDMNAPP----TGHGGLSFGGGLTGIGGRLR-----RLRKPLLCAVHGHVLGLGFELAMC 114 Query: 124 CDIVIAAEDAVFALPEVRLGLIAGAGGVFRLPRQLPQKVAMGYLLTGRRMDAATALRHGL 183 DI+IAA+DAVF LPE ++G+I G V R RQLP VAM ++ G + AA ALR GL Sbjct: 115 ADIIIAADDAVFRLPEAKVGVIDHCGVVHRAIRQLPHHVAMAMIVAGVPLTAADALRFGL 174 Query: 184 VNEVVPAAELDQCVADWTDSLVRAAPLSVRAIKEAALRSVDLPLEEAFTTSYHWEERRRR 243 VN +P AE V W D L+ APL +A ++AAL ++ PL EA SY R+ Sbjct: 175 VNACLPRAEWADGVQQWIDKLLACAPLVSQAARQAALEGLEHPLGEALARSYPLIAAYRQ 234 Query: 244 SADAIEGVRAFAEKRDPIWTGQ 265 S D +E RA+AE+R P W+G+ Sbjct: 235 SDDRLEAERAWAERRPPRWSGR 256 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 256 Length adjustment: 24 Effective length of query: 241 Effective length of database: 232 Effective search space: 55912 Effective search space used: 55912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory