Align 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (characterized)
to candidate WP_079646860.1 B5X82_RS04275 acetyl-CoA C-acyltransferase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2982 (397 letters) >NCBI__GCF_900167915.1:WP_079646860.1 Length = 394 Score = 513 bits (1322), Expect = e-150 Identities = 262/392 (66%), Positives = 310/392 (79%) Query: 3 MSNDPIVIVSAVRTPMGGFQGELKSLTAPQLGAAAIKAAVERAGVASDSVDEVLFGCVLP 62 MS DP+VI S RTPMGGFQG L +A QLGAAA+KAAVERAGV +D V+++ GCVLP Sbjct: 1 MSTDPVVIASYARTPMGGFQGALAGASATQLGAAAVKAAVERAGVDADKVEQIFMGCVLP 60 Query: 63 AGLGQAPARQAALGAGLDKSTRCTTLNKMCGSGMEAAILAHDMLLAGSADVVVAGGMESM 122 GLGQAPARQAALGAGL +S TT+NKMCGSGM+AAI+AHD L AGSADV+VAGGMESM Sbjct: 61 GGLGQAPARQAALGAGLPRSVEATTVNKMCGSGMQAAIMAHDALAAGSADVIVAGGMESM 120 Query: 123 SNAPYLLDRARAGYRMGHGRVQDSMFLDGLEDAYDKGRLMGTFAEDCAETNGFSREAQDA 182 SNAPYLL + R+G R+GH V+DSM+LDGLEDAY G+LMG FAED A +REAQD Sbjct: 121 SNAPYLLAKHRSGARIGHDVVKDSMYLDGLEDAYTPGKLMGAFAEDSARDYQLTREAQDD 180 Query: 183 FAIASTTRAQQAIKDGSFKAEIVPLTVTVGKEQVVISNDEQPPKARLDKIASLKPAFREG 242 +AI S +RA AI+ G+F EI+P+T+ V+ DEQP KAR DKI +LKPAF + Sbjct: 181 YAIRSLSRANAAIESGAFDREIIPVTIETRGGATVVERDEQPGKARPDKIPTLKPAFAKD 240 Query: 243 GTVTAANSSSISDGAAALVLMRQSQAQKQGLKPLAVIHGHAAFADTPGLFPVAPIGAIKK 302 GT+TAAN+SSISDGAAALV+ RQS A+K GL +A + HAA A PGLF AP+ AI+K Sbjct: 241 GTITAANASSISDGAAALVMTRQSVAEKLGLPVVAKVASHAAHAHEPGLFTTAPVPAIQK 300 Query: 303 LMKKTGWSLNDVDLVEVNEAFAVVGMAAMTHLEIPHEKLNVHGGACALGHPIGASGARIL 362 +KK GW+++DVDL EVNEAFAVV M A L IP EKLNV+GGACALGHPIGASGAR+L Sbjct: 301 ALKKAGWTVDDVDLFEVNEAFAVVAMIAAKDLNIPAEKLNVNGGACALGHPIGASGARVL 360 Query: 363 VTLLSALRQKGLKRGVAAICIGGGEATAMAVE 394 TLL+AL+ +GLKRGVA++CIGGGEATAMAVE Sbjct: 361 ATLLAALQNRGLKRGVASLCIGGGEATAMAVE 392 Lambda K H 0.318 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 549 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 394 Length adjustment: 31 Effective length of query: 366 Effective length of database: 363 Effective search space: 132858 Effective search space used: 132858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory