Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Allergen Alt a 8; EC 1.1.1.138 (characterized)
to candidate WP_079647934.1 B5X82_RS09540 acetoacetyl-CoA reductase
Query= SwissProt::P0C0Y4 (266 letters) >NCBI__GCF_900167915.1:WP_079647934.1 Length = 240 Score = 133 bits (335), Expect = 3e-36 Identities = 86/244 (35%), Positives = 128/244 (52%), Gaps = 11/244 (4%) Query: 20 KVVIVTGASGPTGIGTEAARGCAEYGADLAITYNSRAEGAEKNAKEMSEKYGVKVKAYKC 79 +V IVTG G GIG + + G +A Y G E+ A+ ++K G++ +YK Sbjct: 3 RVAIVTG--GTRGIGEAISLALRDAGVAVAANY----AGNEERARAFTDKTGIR--SYKW 54 Query: 80 QVNEYAQCEKLVQDVIKDFGKVDVFIANAGKTADNGILDATVEQWNEVIQTDLTGTFNCA 139 V +Y C K V+ V + G VD+ + NAG T D +L T + W +V+ T+L G FN A Sbjct: 55 DVADYDACHKGVEQVEAELGPVDIVVNNAGITRDGTLLKMTYQDWKDVMDTNLGGCFNMA 114 Query: 140 RAVGLHFRERKTGSLVITSSMSGHIANFPQEQASYNVAKAGCIHLAKSLANEW-RDFARV 198 +A R R G +V S++G + Q +Y AK+G K+LA E + V Sbjct: 115 KATFPGMRARGWGRIVNIGSINGQAGQY--GQVNYAAAKSGIHGFTKALAQEGAKAGVTV 172 Query: 199 NSISPGYIDTGLSDFVPQDIQKLWHSMIPMGRDAKATELKGAYVYFASDASSYCTGSDLL 258 N+I+PGYIDT + VPQD+ + IP+GR A E+ V+ + + + TGS L Sbjct: 173 NAIAPGYIDTDMVAAVPQDVLAKIVAKIPVGRLGHAEEIARGVVFLCGEEAGFVTGSTLS 232 Query: 259 IDGG 262 I+GG Sbjct: 233 INGG 236 Lambda K H 0.316 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 240 Length adjustment: 24 Effective length of query: 242 Effective length of database: 216 Effective search space: 52272 Effective search space used: 52272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory