Align Aromatic amino acid transporter AroP (characterized, see rationale)
to candidate WP_079650895.1 B5X82_RS24315 amino acid permease
Query= uniprot:A0A2Z5MFR8 (461 letters) >NCBI__GCF_900167915.1:WP_079650895.1 Length = 455 Score = 287 bits (734), Expect = 6e-82 Identities = 157/448 (35%), Positives = 251/448 (56%), Gaps = 8/448 (1%) Query: 6 QQDGLKRGLKNRHIQLIALGGAIGTGLFLGSASVLQAAGPSMILGYAIGGVIAFMIMRQL 65 +++GL+RGL R + +I +GGAIGTGLF+GS + AGP ++L Y + VI+ +M L Sbjct: 12 REEGLERGLTRRQLTMIGIGGAIGTGLFMGSGLAIGYAGPGVLLSYLLAAVISLAVMFSL 71 Query: 66 GEMVAQEPVAGSFSHFAYKYWGDFPGFLSGWNYWVLYVLVSMAELTAVGTYVHYWWPGVP 125 EM P AGSF A Y G+++ W YW V++ +E AVG Y+ +W P +P Sbjct: 72 AEMAVLNPTAGSFGTHAELYISPLAGWIARWTYWAEMVILIGSEAVAVGHYLSFWVPALP 131 Query: 126 TWVSALVCFAGINAINLANVKAYGETEFWFAIIKVVAVIGMILFGGYLLVSGHGGPQASI 185 W+S L+ GI +N+ V ++G E+W + IKV A++ IL G +V G G P + Sbjct: 132 VWLSILLSGGGILFVNMRAVGSFGTVEYWLSAIKVAAILAFILL-GLGMVLGVGTPAIGL 190 Query: 186 SNLWSHGGFFPHGFHGLFTMLAVIMFSFGGLELIGITAAEADEPQKSIPKAVNQVIYRIL 245 SN GG P G G++ + +FSF G+E+I + A EAD+P ++P+A+ ++ R+ Sbjct: 191 SNYMVDGGPLPFGLKGVWMGAMIAIFSFFGIEMIAVAAGEADDPGTAVPRAMRTLLVRLC 250 Query: 246 IFYICSLAVLLSLYPWNEVAAG---GSPFVMIFSQIGSTLTANVLNVVVLTAALSVYNSG 302 +FY+ S+A++L++ PW+ A SPFV +F+ G A+V+N VVL AALS NS Sbjct: 251 LFYLLSIAIILAIVPWSSSGAAVVDQSPFVKVFAGFGIVGAASVMNFVVLCAALSAMNSS 310 Query: 303 VYANSRMLYGLAEQGNAPRALMKVDRRGVPYMAIGLSALATFTCVIVNYLIPAEALGLLM 362 +Y SRML+ LA G+AP + ++ VP A S L V L P A ++ Sbjct: 311 LYMASRMLFSLARAGDAPASFGVLNGAAVPARAALASGLGILIAAAVALLSP-RAFEYML 369 Query: 363 ALVVAALVLNWALISLTHLKSRRAMVAAGETLVFKSFWFPVSNWICLAFMALILVILAMT 422 + + + W LI +TH + RR + G L +++ +FP+ I LA + I+ + + Sbjct: 370 GIALFGGLFTWMLILVTHFRFRRRVGTEG--LAYRAPFFPIPQCIGLAGLLAIVAAMLFS 427 Query: 423 PGL-SVSVLLVPLWLVVMWAGYAFKRRR 449 G+ +SV + WL+++ + ++ R Sbjct: 428 GGIWRISVAIGVPWLLLVALIFLLRKAR 455 Lambda K H 0.327 0.140 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 455 Length adjustment: 33 Effective length of query: 428 Effective length of database: 422 Effective search space: 180616 Effective search space used: 180616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory