Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_079646512.1 B5X82_RS02900 acyl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_900167915.1:WP_079646512.1 Length = 384 Score = 134 bits (338), Expect = 3e-36 Identities = 100/342 (29%), Positives = 165/342 (48%), Gaps = 10/342 (2%) Query: 19 LTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYGGSGL 78 LTEE+ M RD+ FAQ LA LE + + R M E GL+G TIPE+ GG G Sbjct: 5 LTEEQSMFRDAVAAFAQRHLAAGALERAHSDDYPWEVARMMAEQGLIGITIPEEKGGLGG 64 Query: 79 NYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFG 138 + + + + + ++ + + +F ++AQK++YL L G+ + Sbjct: 65 SLMDAVIAIETIASVCPRSADVVQAGNFGAIRTFAQFASDAQKEQYLAPLLKGDGLISVA 124 Query: 139 LTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAK--DDAGDIRGFVL 196 +TEPN GS + T A G+R++G K++ T+ A VF+V+ + G+I ++ Sbjct: 125 MTEPNAGSAVTELTTTAVPDGDGFRVSGQKIFTTHGTHATVFLVYVRYGPGTGNIGSVLI 184 Query: 197 EKGWQGLSAPAIHGKVG--LRASITGEIVMDNVFVPEENIFPDVRGLKGPFTCLNSARYG 254 E+G +G S GK L + DNV+VP++ + G K + N R G Sbjct: 185 ERGQEGFS----FGKPVRFLSGEEWNPLFFDNVYVPKDKVLLGPGGFKQQMSGFNVERIG 240 Query: 255 ISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRM 314 + +L ++ A ++ R+QFGR L Q +Q K A+M+ ++ A R Sbjct: 241 NTARSLALGRYAFNAAVEHAKTRKQFGRALCEFQGLQWKFAEMKLKLDAAQLLLYRAATN 300 Query: 315 KDEGTAAVEITSIMKRNSCGKA-LDIARMARDMLGGNGISDE 355 D+G + + T+I K +C +A D A A ++GG G S + Sbjct: 301 ADKGLPSPDETAIAK-VACNRAGFDCANEAMQVMGGAGYSQD 341 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 384 Length adjustment: 30 Effective length of query: 363 Effective length of database: 354 Effective search space: 128502 Effective search space used: 128502 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory