Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_079646489.1 B5X82_RS02775 enoyl-CoA hydratase
Query= BRENDA::Q5SLK3 (254 letters) >NCBI__GCF_900167915.1:WP_079646489.1 Length = 265 Score = 178 bits (451), Expect = 1e-49 Identities = 109/262 (41%), Positives = 155/262 (59%), Gaps = 8/262 (3%) Query: 1 MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAG 60 ++++ R +GV V+TLNRP++LNA+T E + AL A L D RA++LTGAGR F +G Sbjct: 4 ILVERRDEGVAVVTLNRPQRLNALTREAVAALNATLDGIAADAGCRAVILTGAGRGFCSG 63 Query: 61 QDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPL-------VVAVNGVAAGAGMSLALWG 113 QDL RK D + + E +G+ K L + AVNG A GAGM++AL Sbjct: 64 QDLAAANARKGDRASGVVEKLFWQEQFAGMGKRLRSMPQLVIAAVNGPAVGAGMAIALSA 123 Query: 114 DLRLAAVGASFTTAFVRIGL-VPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGL 172 D+R+A A F A VRIGL +SG+S+LLPR++G+++A ++LL + AEEA +GL Sbjct: 124 DVRIATPSARFLVAAVRIGLSAGESGISYLLPRMIGISRAFDILLTGRPIEAEEAERIGL 183 Query: 173 VHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQ 232 V R+ L++EA+ A+ + + A +KKL+ E S A+ E Q A Sbjct: 184 VLRLAEPAALVDEAIGYARAVLANSPYSVAHSKKLMWENLDASFDAAIGAENRTQILATM 243 Query: 233 TQDHEEGVRAFREKRPPRFQGR 254 TQD+ E AF EKRPPRF+GR Sbjct: 244 TQDYAEATAAFVEKRPPRFEGR 265 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 265 Length adjustment: 24 Effective length of query: 230 Effective length of database: 241 Effective search space: 55430 Effective search space used: 55430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory