Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_079646856.1 B5X82_RS04265 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_900167915.1:WP_079646856.1 Length = 263 Score = 177 bits (448), Expect = 3e-49 Identities = 104/260 (40%), Positives = 144/260 (55%), Gaps = 7/260 (2%) Query: 5 ILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQ 64 +L E V LTLNRPE N+ + ++ L E D IRC+ LTGAGR FCAG Sbjct: 6 LLVEREGAVAKLTLNRPEAANALDIDLARALVTAALDCEYDPAIRCVTLTGAGRLFCAGG 65 Query: 65 DLNDRNVDPTGPAPDLGMSVERFYNPL---VRRLAKLPKPVICAVNGVAAGAGATLALGG 121 D+ G + + L + LA++ KP++ VNG AAGAG +AL G Sbjct: 66 DV----AYMAGAGDKTAAATAELASTLHLAMSHLARMGKPLVTIVNGPAAGAGYGMALSG 121 Query: 122 DIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMI 181 D+V+ ARSA F A+ LG+ PD G TWLLPR+ G RA + L ++ AE+A G++ Sbjct: 122 DVVLMARSASFTPAYGMLGVSPDGGLTWLLPRLVGLRRAQEIILTNRKVGAEEAEAMGLV 181 Query: 182 WQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRS 241 + VDD+TLA +A LA T+ +G ++ + + N+ +T L+LE A S Sbjct: 182 TRAVDDDTLAAEGAAIAAKLAASATYAIGSVRALLLDSYANSWETHLELEARGIASAISS 241 Query: 242 ADYREGVSAFLAKRSPQFTG 261 D +EGV+AFLAKR P FTG Sbjct: 242 RDGQEGVAAFLAKRKPDFTG 261 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 263 Length adjustment: 25 Effective length of query: 237 Effective length of database: 238 Effective search space: 56406 Effective search space used: 56406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory