Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_079649373.1 B5X82_RS16470 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_900167915.1:WP_079649373.1 Length = 263 Score = 274 bits (700), Expect = 2e-78 Identities = 143/257 (55%), Positives = 172/257 (66%), Gaps = 2/257 (0%) Query: 5 ILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQ 64 IL V G LTLNRP+RLN+F MH ++ E L ++E D R LL+TGAGRGFCAGQ Sbjct: 6 ILLDVAGGAYRLTLNRPDRLNAFTARMHEEVREALTRIEGDPAARVLLITGAGRGFCAGQ 65 Query: 65 DLNDRNVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIV 124 DL +R+V GP DL E YNPL RRL LP PV+CAVNGVAAGAG +A DIV Sbjct: 66 DLAERDVS-AGPL-DLSQGPEHDYNPLARRLVALPVPVVCAVNGVAAGAGVNIAAACDIV 123 Query: 125 IAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQV 184 IA +SAKF AFS +GL+PD GGTW LPR+ G+ARA+G LL LSAEQA G+IW+ Sbjct: 124 IARKSAKFAQAFSAIGLVPDTGGTWHLPRLMGQARALGFTLLNETLSAEQAEAMGLIWRA 183 Query: 185 VDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSADY 244 +DD+ + + LA PTFGL K+A+ +A T+TLD LD ERD QR G S DY Sbjct: 184 IDDDAFEAEVEAIVARLAAAPTFGLASAKKALRAAWTSTLDEALDRERDMQRDCGLSPDY 243 Query: 245 REGVSAFLAKRSPQFTG 261 +EGV+AF KR P FTG Sbjct: 244 KEGVTAFKDKRKPGFTG 260 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 263 Length adjustment: 25 Effective length of query: 237 Effective length of database: 238 Effective search space: 56406 Effective search space used: 56406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory