Align Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 (characterized)
to candidate WP_079651075.1 B5X82_RS24930 Rieske 2Fe-2S domain-containing protein
Query= SwissProt::Q84BZ3 (423 letters) >NCBI__GCF_900167915.1:WP_079651075.1 Length = 400 Score = 182 bits (461), Expect = 2e-50 Identities = 127/397 (31%), Positives = 200/397 (50%), Gaps = 33/397 (8%) Query: 29 VPYKVFSSRAVYDREQERIFRGPTWNFVALEAEIPNAGDFKSTFVGDTPVVVTRTEDGAL 88 +P +FS +Y E +RIFRG W+ VA AE+P FK+ ++G+TPV++TR ED L Sbjct: 33 IPKAIFSDPTIYREELKRIFRGHYWHMVAHRAELPEVNSFKTFWLGETPVLLTRGEDETL 92 Query: 89 SAWVNRCAHRGAQVCRKSRGNASSHTCVYHQWSFDNEGNLLGVPFRRGQKGMTGMPADFD 148 A+VN C HRG + +++ G + C YH+W F N+GN +G P RR + ADF Sbjct: 93 RAFVNSCTHRGTLLEQRATGCSKEFECPYHRWLFSNKGNFIGGPGRRDFR------ADFV 146 Query: 149 PKQHGLRKLRVDSYRGLVFATFSDDVAPLPDYLGAQMRPWIDRIFHK-PIEYLGCTRQYS 207 + + LR+L+VD GL+F + + V+ L +LG D + + LG Sbjct: 147 AEDYALRELQVDEIAGLIFCSAAPQVS-LEQWLGQCAGHVRDVMLDDGRLTLLGYQNAIF 205 Query: 208 KSNWKLYMENVKDPYHASMLHLFHTTFNIFRVGMKARSIPDANHGLHSIITVTKTGDDTS 267 +NWK Y +N D YHA +LH+ G + S HG + V + S Sbjct: 206 NANWKTYFDN--DFYHAPLLHM----------GFRLLSW----HGGQGEVRVEEPVGHFS 249 Query: 268 AAYKQQNIRSFDEGFHLEDESILDLVSEYDEDCTNHIQPIFPQLVIQQIHNTLVARQILP 327 Y+ D GF L D S++++ D + + P V+ + +T+ R + P Sbjct: 250 VGYESSPYE--DNGF-LADPSLVEMKG---TDARARVVALRPAYVLTKHLDTISVRFVRP 303 Query: 328 KGPDNFELIFHFFGYADDTPELRALRIKQA-NLVGPAGYISMEDTEATELVQRGTVRDAD 386 G D ++ + FFG+ D+PE RA R++QA NL+GP+G I++ED A Q+ T RD Sbjct: 304 LGVDRTQVTYAFFGHESDSPEYRAHRVRQASNLLGPSGMITIEDA-AVFNRQQMTSRDGG 362 Query: 387 ATSVIEMSRGNPEQQDTVITESLIRKFWVGYQKLMGY 423 + + + P + E+ W Y+++MG+ Sbjct: 363 MSRFV-VGVDRPAAEARQNDENGNTAGWAYYREVMGF 398 Lambda K H 0.321 0.136 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 400 Length adjustment: 31 Effective length of query: 392 Effective length of database: 369 Effective search space: 144648 Effective search space used: 144648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory