Align 2-oxopent-4-enoate hydratase subunit (EC 4.2.1.80) (characterized)
to candidate WP_079648262.1 B5X82_RS11330 2-oxo-hepta-3-ene-1,7-dioic acid hydratase
Query= metacyc::MONOMER-3403 (222 letters) >NCBI__GCF_900167915.1:WP_079648262.1 Length = 268 Score = 169 bits (427), Expect = 6e-47 Identities = 92/228 (40%), Positives = 142/228 (62%), Gaps = 9/228 (3%) Query: 2 DKTLINELGDELYQAMVQRETVTPLTSRGFD-ISVEDAYHISLRMLERRLAAGERVIGKK 60 D+TL+ EL L +A RE + SR +D ++++DAY + ++R++AAG+ VIG K Sbjct: 4 DRTLVAELAARLDRAEQDREQIAQF-SRAYDGMTMDDAYAVQAAWIDRKVAAGQTVIGHK 62 Query: 61 IGVTSKAVQNMLGVHQPDFGYLTDAMVYNSGEAMPISEKLIQPRAEGEIAFILKKDLMGP 120 IG+TS+A+Q + + +PD+G L M ++ G+ +PI E+ I+PR E EIAF+L+K L GP Sbjct: 63 IGLTSRAMQRAVNITEPDYGVLLSPMRFHDGQTIPI-ERFIEPRVEVEIAFVLRKPLEGP 121 Query: 121 GVTNADVLAATECVIPCFEVVDSRIQ------DWKIKIQDTVADNASCGLFVLGDQAVSP 174 T DVL AT+ V+P E++D+RI+ + DT+ADNA+ V+G + + P Sbjct: 122 DCTIFDVLNATDHVVPAVEIIDARIERHDRNGGGTRTVLDTIADNAANAGIVIGGRPMRP 181 Query: 175 RQVDLVTCGMLVEKNGQLLSTGAGAAALGSPVNCVAWLANTLGHFGIA 222 +DL ++ +NG++ TG GAA L P N AWLAN L FG++ Sbjct: 182 DAIDLRWAPAILYRNGEIEETGVGAAVLNHPANGPAWLANRLSRFGVS 229 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 268 Length adjustment: 24 Effective length of query: 198 Effective length of database: 244 Effective search space: 48312 Effective search space used: 48312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory