Align 2-keto-4-pentenoate hydratase; 2-hydroxypentadienoic acid hydratase; EC 4.2.1.80 (characterized)
to candidate WP_079650226.1 B5X82_RS21455 2-keto-4-pentenoate hydratase
Query= SwissProt::Q9S156 (260 letters) >NCBI__GCF_900167915.1:WP_079650226.1 Length = 269 Score = 263 bits (671), Expect = 4e-75 Identities = 138/250 (55%), Positives = 173/250 (69%), Gaps = 2/250 (0%) Query: 11 AERLRHAEATATPIAPLREEITDN--DSAYAVQLVNVQYAQSQGRRIVGRKIGLTSLAVQ 68 A +LR A+ +AP+RE D + AYA+Q N + ++Q R +VG KIGLT+ AVQ Sbjct: 16 AAQLRDCYASGVAMAPIREAFPDAKIEDAYAIQAANTAHWEAQDRVVVGAKIGLTAKAVQ 75 Query: 69 KQLGVDQPDFGTLFADMLYGDDEAVPLSRTLQPKVEAEVALVLAKDLERPDTTLVDVISA 128 QLGVDQPDFG LFADM D + V R LQPKVEAE+A ++A + T ++I + Sbjct: 76 GQLGVDQPDFGHLFADMAVADGDIVAAGRLLQPKVEAEIAFIMAHTPDAARLTTAELIDS 135 Query: 129 TAYVLPAIEIVGSRIADWNIRFIDTVADNASSGLVVLGAVPTALNALDLKLCQMQMTRNG 188 AY LPAIEIV SRIA WNI +DTVADNASSGL VLG P +L A+DL+LC M + RNG Sbjct: 136 VAYALPAIEIVDSRIAGWNIGIVDTVADNASSGLFVLGTRPVSLGAIDLRLCGMVLERNG 195 Query: 189 DVVSTGSGGACLGHPLNAAVWLARRLANLGQPLRAGDLVLTGALGPMVAVNAGDRFEARI 248 + S G+G ACLG+PL+A WLA ++A +G+PL GD+VL+GALGPMVAV GD EARI Sbjct: 196 EPTSFGAGAACLGNPLHALGWLAAKMAEVGRPLAQGDIVLSGALGPMVAVAPGDSVEARI 255 Query: 249 SGIGSVCAQF 258 G+GSV F Sbjct: 256 GGLGSVRVGF 265 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 269 Length adjustment: 25 Effective length of query: 235 Effective length of database: 244 Effective search space: 57340 Effective search space used: 57340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory