Align 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.39 (characterized)
to candidate WP_079649142.1 B5X82_RS15795 hypothetical protein
Query= SwissProt::O05151 (258 letters) >NCBI__GCF_900167915.1:WP_079649142.1 Length = 259 Score = 91.7 bits (226), Expect = 1e-23 Identities = 67/208 (32%), Positives = 97/208 (46%), Gaps = 5/208 (2%) Query: 6 NSFKKALAEGRTQIGFWL-ALGDAYSAEVCAGAGFDWLLIDGEHAPQDLRSVLAQLQVIG 64 N K LA G G + L A A AG ++++ D EH+ D + Q + Sbjct: 4 NPLKARLAAGEHIYGTMMFELLSAGLPAAMAAAGAEFIIYDMEHSGFDYMQMKDQFALTR 63 Query: 65 AYRDCHAAVRVPSADTTVIKQYLDLGAQSLLVPMVDTADEAAAVVRACRYPPGGIRGV-- 122 D A VR P + + + LDLGA L+ M ++ E ++ RYPP G RG Sbjct: 64 GL-DLVAMVRPPEKSYSAVSRLLDLGAMGFLLQMSESVAEIREIISWTRYPPEGRRGAVF 122 Query: 123 GGARASRW-GRYPRYLHEADEQVCVVVQAETALALSNLEAIAEVDGIDGVFIGTADLAAS 181 GGA G P + A E+ ++ ETA L+ ++ IA VDG+DG+ +G DL S Sbjct: 123 GGAHDDYAPGPIPEKMRIARERTIIMPLIETARGLAAVDEIAAVDGVDGLHLGQFDLTLS 182 Query: 182 LGFPGNPAHPEVQDAILDALQRVRAAGK 209 +G PG HP+ A+ + L GK Sbjct: 183 MGIPGQFEHPDFLAAVDNILAACHRHGK 210 Lambda K H 0.320 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory