Align 3-hydroxyanthranilate 3,4-dioxygenase; 3-hydroxyanthranilate oxygenase; 3-HAO; 3-hydroxyanthranilic acid dioxygenase; HAD; EC 1.13.11.6 (characterized)
to candidate WP_079646745.1 B5X82_RS03880 3-hydroxyanthranilate 3,4-dioxygenase
Query= SwissProt::Q1LCS4 (174 letters) >NCBI__GCF_900167915.1:WP_079646745.1 Length = 183 Score = 205 bits (522), Expect = 3e-58 Identities = 93/169 (55%), Positives = 124/169 (73%), Gaps = 1/169 (0%) Query: 6 APFNFPRWIDEHAHLLKPPVGNRQVWQD-SDFIVTVVGGPNHRTDYHDDPLEEFFYQLRG 64 APF +WI ++ HLL+PPV N+ +++D S IV ++GG N RTD+HDDP++EFFYQL+G Sbjct: 7 APFRLDQWIADNRHLLQPPVSNKLLFEDKSGMIVQIIGGGNRRTDFHDDPVQEFFYQLKG 66 Query: 65 NAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWY 124 + L + DG + EG+++LLPPH+ HSPQRP+ S LV+E +R GMLDGF WY Sbjct: 67 DMILKVHEDGAVRDIRIGEGEVYLLPPHIPHSPQRPDPDSIGLVLEGERRPGMLDGFVWY 126 Query: 125 CDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRA 173 C CG V RVEV L+ IV DLPPLF++FYASE++R C CG+VHPG+A Sbjct: 127 CFGCGAQVDRVEVALQDIVADLPPLFDAFYASEERRTCRACGEVHPGKA 175 Lambda K H 0.324 0.143 0.481 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 174 Length of database: 183 Length adjustment: 19 Effective length of query: 155 Effective length of database: 164 Effective search space: 25420 Effective search space used: 25420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 44 (21.6 bits)
Align candidate WP_079646745.1 B5X82_RS03880 (3-hydroxyanthranilate 3,4-dioxygenase)
to HMM TIGR03037 (nbaC: 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03037.hmm # target sequence database: /tmp/gapView.3133241.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03037 [M=159] Accession: TIGR03037 Description: anthran_nbaC: 3-hydroxyanthranilate 3,4-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-70 221.9 0.0 2.6e-70 221.7 0.0 1.0 1 NCBI__GCF_900167915.1:WP_079646745.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900167915.1:WP_079646745.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.7 0.0 2.6e-70 2.6e-70 2 159 .] 10 169 .. 9 169 .. 0.97 Alignments for each domain: == domain 1 score: 221.7 bits; conditional E-value: 2.6e-70 TIGR03037 2 nlkkwidehkellkppvgnkqiwqd.selivtvvGGpnkrtdfhvdeseeffyqlkGemvlkvleeGkvedvp 73 l +wi ++++ll+ppv+nk +++d s++iv ++GG n+rtdfh+d+++effyqlkG+m+lkv e+G v+d+ NCBI__GCF_900167915.1:WP_079646745.1 10 RLDQWIADNRHLLQPPVSNKLLFEDkSGMIVQIIGGGNRRTDFHDDPVQEFFYQLKGDMILKVHEDGAVRDIR 82 6899*******************9935799******************************************* PP TIGR03037 74 ireGdifllppkvphspqra.agsiglvierkrkegeldalqwfcaecgeklyraevklesivkdlppvfekf 145 i eG+++llpp++phspqr+ +siglv+e +r++g ld+++w+c+ cg ++ r+ev l++iv+dlpp+f++f NCBI__GCF_900167915.1:WP_079646745.1 83 IGEGEVYLLPPHIPHSPQRPdPDSIGLVLEGERRPGMLDGFVWYCFGCGAQVDRVEVALQDIVADLPPLFDAF 155 ********************88*************************************************** PP TIGR03037 146 yssedartckkcGe 159 y+se+ rtc+ cGe NCBI__GCF_900167915.1:WP_079646745.1 156 YASEERRTCRACGE 169 *************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (159 nodes) Target sequences: 1 (183 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.30 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory