Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate WP_079648262.1 B5X82_RS11330 2-oxo-hepta-3-ene-1,7-dioic acid hydratase
Query= metacyc::MONOMER-15110 (260 letters) >NCBI__GCF_900167915.1:WP_079648262.1 Length = 268 Score = 192 bits (487), Expect = 8e-54 Identities = 105/260 (40%), Positives = 160/260 (61%), Gaps = 7/260 (2%) Query: 2 DKTVIKDLARFLVDAEVEKKEVLKLTNEHPDLTVEDGYAIQEQLVQMKLEQGYRIVGPKM 61 D+T++ +LA L AE +++++ + + + +T++D YA+Q + K+ G ++G K+ Sbjct: 4 DRTLVAELAARLDRAEQDREQIAQFSRAYDGMTMDDAYAVQAAWIDRKVAAGQTVIGHKI 63 Query: 62 GLTSQAKMKQMNVNEPIYGYIFDYMVVN-GQELSMSELIHPKVEAEIAFILGKDIEGPGI 120 GLTS+A + +N+ EP YG + M + GQ + + I P+VE EIAF+L K +EGP Sbjct: 64 GLTSRAMQRAVNITEPDYGVLLSPMRFHDGQTIPIERFIEPRVEVEIAFVLRKPLEGPDC 123 Query: 121 TGAQVLAATEYVVPALEIIDSRYQNFQF------TLPDVIADNASSSRVFLGSTIKRPDN 174 T VL AT++VVPA+EIID+R + T+ D IADNA+++ + +G RPD Sbjct: 124 TIFDVLNATDHVVPAVEIIDARIERHDRNGGGTRTVLDTIADNAANAGIVIGGRPMRPDA 183 Query: 175 MELDLLGVTLSINGQIKDLGAGAAVVGHPANSVAMLANMLARKGLKLKAGQIILSGGITG 234 ++L L NG+I++ G GAAV+ HPAN A LAN L+R G+ L+AG+IIL G TG Sbjct: 184 IDLRWAPAILYRNGEIEETGVGAAVLNHPANGPAWLANRLSRFGVSLQAGEIILGGSFTG 243 Query: 235 AVMLNVGDSVTGKFDGLGTI 254 V + GDS F LG+I Sbjct: 244 QVFVRRGDSFHVDFGPLGSI 263 Lambda K H 0.317 0.137 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 268 Length adjustment: 25 Effective length of query: 235 Effective length of database: 243 Effective search space: 57105 Effective search space used: 57105 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory