Align 2-hydroxymuconate-6-semialdehyde hydrolase (EC 3.7.1.9) (characterized)
to candidate WP_079648356.1 B5X82_RS11830 alpha/beta fold hydrolase
Query= BRENDA::G3KFX4 (282 letters) >NCBI__GCF_900167915.1:WP_079648356.1 Length = 299 Score = 112 bits (279), Expect = 1e-29 Identities = 83/255 (32%), Positives = 124/255 (48%), Gaps = 10/255 (3%) Query: 32 VLLIHGSGPGVTAWANWRLVMPQLAQNRRVIAPDMLGFGYSDRPADGRYHQQRWVEHAIG 91 +LL+HG G A++ + ++ V+A DMLG G++D+PA Y + H + Sbjct: 45 LLLLHGVGGHAEAYSR---NLGSHGEHFWVVAIDMLGHGWTDKPAID-YQVADYARHVLD 100 Query: 92 VLDALGIQQADIVGNSFGGGLALALAIRHPERVRRLVLMGSVG-VSFPITPG----LDAV 146 V+ ALG +A + G S GG +A LA+ HPE V RLVL S G + P L Sbjct: 101 VMRALGRDRAHLSGESLGGWVATYLAVHHPEAVERLVLNTSGGWTAHPEVMARLKRLSNE 160 Query: 147 WGYEPSFASMRRLMDVFAYDRSLVTNELAELRYQASIRPGFQESFAQMFPAPRQRWVDGL 206 +PS+ +R ++ +D+++VT++L E R +PGF E+ A++ Sbjct: 161 AAADPSWDRIRARLEFLMFDKTMVTDDLVETRRAIYAQPGFAETMARIMCLQEMEIRRPN 220 Query: 207 ASDEADIRALPHETLVIHGREDQVIPLAASLTLAEWIARAQLHVFGHCGHWTQIEHAERF 266 E R++ ++VI D +AE I A+ V HCGHW Q E A+ F Sbjct: 221 MITEDQYRSIKAPSMVIWTSHDPTATPEEGRQIAEMIPDARYVVMNHCGHWPQYEDADVF 280 Query: 267 ARLVENFL-AEADAL 280 RL FL EAD L Sbjct: 281 NRLHIAFLRGEADPL 295 Lambda K H 0.323 0.138 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 299 Length adjustment: 26 Effective length of query: 256 Effective length of database: 273 Effective search space: 69888 Effective search space used: 69888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory