Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate WP_079646856.1 B5X82_RS04265 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::Q9LKJ1 (378 letters) >NCBI__GCF_900167915.1:WP_079646856.1 Length = 263 Score = 94.0 bits (232), Expect = 4e-24 Identities = 70/220 (31%), Positives = 105/220 (47%), Gaps = 7/220 (3%) Query: 7 SQSQVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAFEEDPSVKLVILKGHGRAF 66 S + +LVE + +V LTLNRP+ NAL + L+ L E DP+++ V L G GR F Sbjct: 2 SAANLLVEREGAVAKLTLNRPEAANALDIDLARALVTAALDCEYDPAIRCVTLTGAGRLF 61 Query: 67 CAGGDVAAVVRDINQGNWRLGANYFSSEYMLNYVMATYSKAQVSILNGIVMGGGAGVSVH 126 CAGGDV A + A S+ ++ +A K V+I+NG G G G+++ Sbjct: 62 CAGGDV-AYMAGAGDKTAAATAELASTLHLAMSHLARMGKPLVTIVNGPAAGAGYGMALS 120 Query: 127 GRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGF-FGEYVGLTGARLDGAEMLACGL 185 G + + F LG+ PD G ++ L RL G + + LT ++ E A GL Sbjct: 121 GDVVLMARSASFTPAYGMLGVSPDGGLTWLLPRLVGLRRAQEIILTNRKVGAEEAEAMGL 180 Query: 186 ATHFVPSTRLTALEADLCRINSNDPTFA-----STILDAY 220 T V L A A + + T+A + +LD+Y Sbjct: 181 VTRAVDDDTLAAEGAAIAAKLAASATYAIGSVRALLLDSY 220 Lambda K H 0.321 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 263 Length adjustment: 27 Effective length of query: 351 Effective length of database: 236 Effective search space: 82836 Effective search space used: 82836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory