Align 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial; 3-hydroxyisobutyryl-coenzyme A hydrolase; HIB-CoA hydrolase; HIBYL-CoA-H; EC 3.1.2.4 (characterized)
to candidate WP_079649373.1 B5X82_RS16470 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= SwissProt::Q6NVY1 (386 letters) >NCBI__GCF_900167915.1:WP_079649373.1 Length = 263 Score = 77.8 bits (190), Expect = 3e-19 Identities = 52/161 (32%), Positives = 80/161 (49%), Gaps = 5/161 (3%) Query: 38 VLLEKKGCTGVITLNRPKFLNALTLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAG 97 +LL+ G +TLNRP LNA T M ++ L + E DP +++I GAG + FCAG Sbjct: 6 ILLDVAGGAYRLTLNRPDRLNAFTARMHEEVREALTRIEGDPAARVLLITGAG-RGFCAG 64 Query: 98 GDIRVISEAEKAKQKIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFR 157 D+ + ++ + L + + P V ++G+ G GV ++ Sbjct: 65 QDLAE-RDVSAGPLDLSQGPEHDYNPLARRLVALPVPVVCAVNGVAAGAGVNIAAACDIV 123 Query: 158 VATEKCLFAMPETAIGLFPDVGGGYFLPRLQGK---LGYFL 195 +A + FA +AIGL PD GG + LPRL G+ LG+ L Sbjct: 124 IARKSAKFAQAFSAIGLVPDTGGTWHLPRLMGQARALGFTL 164 Lambda K H 0.320 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 263 Length adjustment: 27 Effective length of query: 359 Effective length of database: 236 Effective search space: 84724 Effective search space used: 84724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory