Align 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase; 3-hydroxybenzoyl-CoA synthetase; EC 6.2.1.27; EC 6.2.1.37 (characterized)
to candidate WP_101589454.1 BJEO58_RS10625 AMP-binding protein
Query= SwissProt::Q9AJS8 (523 letters) >NCBI__GCF_900169175.1:WP_101589454.1 Length = 513 Score = 183 bits (464), Expect = 2e-50 Identities = 139/462 (30%), Positives = 213/462 (46%), Gaps = 20/462 (4%) Query: 59 GVGKGDRVLFLMDDSPELVAAYLGTLRIGAVAVALNVRLAPRDVLYVIQDSACRLLYID- 117 G+ GDR++ + PE VA + G G V VA+N R++ Y+++DS RL+ Sbjct: 60 GLQPGDRIILIAPSCPEFVAEFFGAQAAGLVVVAVNPLSTSREIDYLLEDSGARLIVAHP 119 Query: 118 --AEFLHLYQQIAGELEQPPQVVVRGDEAPAPAIIAFKHFLDGQAATLESVQVAPDDVAY 175 AE + AG + V P D V+ + DD+A Sbjct: 120 SRAEAGRTSAKAAGVAYRLIDAVPSDGPEIRPD--------DRGDVDFTVVERSHDDLAA 171 Query: 176 WLYSSGTTGRPKAVMHAHRSVLIADRLEREYFGIKPGDRVFTTSKMFFGWSLGHSLMGGL 235 LY+SGTTG PK M ++L + E + P D T +F + L + L Sbjct: 172 LLYTSGTTGHPKGAMLTVGNLLATVDIVGEITAVGPDDHWATGLPLFHVFGLVTVTLSSL 231 Query: 236 QCGATVIVAPGWPDAERVMATAARHRPTILFSTPVMYRNLLREGAGESAAMRDIRHFVSA 295 + G V + P W V A A R TI+ P M+ ++L E A A +R S Sbjct: 232 RAGVPVTLFPRWDPRTFVEALTA-DRVTIVSGVPTMWMSVLAEAADSPAP--TLRAVSSG 288 Query: 296 GEKLPENIGQQWLDTFGIPITEGIGASETVFLFLCARPDAYR-IGSCGKRVPWAEVRLLD 354 G + ++ +++ + + P+ EG G +ET + R +GS G VP +V+++D Sbjct: 289 GAAISADVLRRFEERYAAPVVEGYGLTETSAVGTFNPLHGIRKVGSVGHAVPRMDVKVVD 348 Query: 355 ELGNEITTPDTPGLIAIRMASQFVGYWKLPETTEKAL-RDGWYYPGDMFSFDADGFWYHN 413 GN+ P PG + +R + GYW PE T + L DGW+ GD+ D DG+ + Sbjct: 349 LDGND-AAPGEPGEVCLRGPAVMRGYWNRPEATAEVLDDDGWFRTGDIGKLDEDGYLFIV 407 Query: 414 GRADDMLKISGQWVSPGEIESCASAVPGIAEAVVVAVPNDDGLTRLTLFIVPEDPSASQQ 473 R D++ G V P E+E +PG+ EA VV P+D ++T I + SQ Sbjct: 408 DRMKDLIIHGGYNVYPREVEEVLYEIPGVREAAVVGTPDDRYGQQVTAVIARSE--GSQL 465 Query: 474 KLSEAWMTTLRGTLSIYKCPRTIQFLEELPRTATGKVQKYRL 515 +E T R L+ YK PR I+F++ELP+ +GK+ K L Sbjct: 466 DAAEVERVT-REELAAYKIPRIIEFIDELPKGPSGKILKRAL 506 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 773 Number of extensions: 40 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 523 Length of database: 513 Length adjustment: 35 Effective length of query: 488 Effective length of database: 478 Effective search space: 233264 Effective search space used: 233264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory