Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_101587823.1 BJEO58_RS03525 enoyl-CoA hydratase
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_900169175.1:WP_101587823.1 Length = 260 Score = 147 bits (370), Expect = 3e-40 Identities = 86/250 (34%), Positives = 141/250 (56%), Gaps = 5/250 (2%) Query: 6 VSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFAAGADL 65 + R VL++ L+R RNA+++ + L L A D + ++TG R F+AG DL Sbjct: 16 LERHDHVLVIHLDRTDKRNAIDSHMTSALDAALNEADDDPEVRCIILTGGERAFSAGTDL 75 Query: 66 NEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAGENARF 125 D A T + ++ PLIAAV G A G G E+ L CD+VVA ARF Sbjct: 76 -----ADGAGTPTERGGPYGVIRRSRRTPLIAAVEGIAYGGGFEVVLACDMVVAHRTARF 130 Query: 126 GLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLE 185 GLPE+ G++P GG R S+ ++A +MVL+G ++AQ+A + G+V+++ L Sbjct: 131 GLPEVARGVIPTCGGLFRGWHSLPVTVAKQMVLTGRPLSAQRAYELGIVNELADDGEVLT 190 Query: 186 YALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEGISAFL 245 AL LA++++ +SPL++ + + + + G ++ + T + ++ED EG++AFL Sbjct: 191 TALDLAAQVSENSPLSVAESLTVMNDVLGMPEELGWSRTDEATTTVKSSEDYREGVAAFL 250 Query: 246 QKRTPDFKGR 255 +KR+P +KGR Sbjct: 251 EKRSPQWKGR 260 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 260 Length adjustment: 24 Effective length of query: 231 Effective length of database: 236 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory