Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_101588281.1 BJEO58_RS04995 ABC transporter ATP-binding protein
Query= TCDB::Q9WXN5 (330 letters) >NCBI__GCF_900169175.1:WP_101588281.1 Length = 348 Score = 179 bits (454), Expect = 9e-50 Identities = 117/306 (38%), Positives = 161/306 (52%), Gaps = 11/306 (3%) Query: 21 SVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLTL-VDGKIFLRVNGEFV 79 ++ V G+ I EV G+VGESG GK+ + + M ++ P T +DG I R+ G+ + Sbjct: 22 TIPIVKGIDLTIEPGEVFGLVGESGSGKSVTA-LATMGLLDPRTAHIDGSI--RLQGDEL 78 Query: 80 ELSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAESHG-IDEEELLDKAR 138 L T R G ++++ Q M AL P + + +H I +E ++ Sbjct: 79 -LGGSTGRGANRSLRGSRVSMVFQEPMTALDPVFTIGSQLTETLRAHTRISAKEAKKRSI 137 Query: 139 RRFEEVGL-DPLW-IKRYPFELSGGMRQRAVIAIATILNPSLLIADEPTSALDVVNQKVL 196 + VG+ DP YP ELSGGMRQR VIAIA + P LLIADEPT+A+D Q L Sbjct: 138 DMLDSVGIVDPAARFHSYPHELSGGMRQRVVIAIALLCGPELLIADEPTTAVDATVQLQL 197 Query: 197 LKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAPVESLLEKPLHPYTQ 256 L ++ + + S++FITHD+ V I DRM MYAG+IVE V ++L P HPYT Sbjct: 198 LDLIREAC-EATGTSVLFITHDLGVVSHICDRMATMYAGEIVETGDVSAVLSAPQHPYTA 256 Query: 257 GLFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAMDVCKEKEPPLTEIEP 316 L ++ P PE + +TTIPG P P GC F RC AMD C++ PPL Sbjct: 257 ALLGAL--PRPETRGTTLTTIPGRVPVPGTEPEGCWFADRCAFAMDECRDSHPPLATGPN 314 Query: 317 GRRVAC 322 G C Sbjct: 315 GSLTRC 320 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 348 Length adjustment: 28 Effective length of query: 302 Effective length of database: 320 Effective search space: 96640 Effective search space used: 96640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory