Align crotonase (EC 4.2.1.150) (characterized)
to candidate WP_101588405.1 BJEO58_RS05430 crotonase/enoyl-CoA hydratase family protein
Query= metacyc::MONOMER-13469 (259 letters) >NCBI__GCF_900169175.1:WP_101588405.1 Length = 302 Score = 161 bits (408), Expect = 1e-44 Identities = 101/263 (38%), Positives = 150/263 (57%), Gaps = 16/263 (6%) Query: 6 IILEKDGNVASITLNRPKALNALN-----AATLKEIDAAINDIAEDDNVYAVIITGSGKA 60 +++E+DG+V + TLNRP + N ++ AA + +DAA D A V VI+TG+GKA Sbjct: 41 LLVERDGHVETWTLNRPDSRNPISDDDMVAAIIDAVDAANADPA----VRVVILTGAGKA 96 Query: 61 FVAGADIAEMKDLTAV-EGRKFSVLGN------KIFRKLENLEKPVIAAINGFALGGGCE 113 F AG D+ +M+D + + G + G +I L+ L+ P+IAA+NG A+G GC+ Sbjct: 97 FSAGGDVKKMRDRSGMFGGHPHQMRGGYRYGIQQIPLALQRLDAPLIAAVNGPAVGAGCD 156 Query: 114 LSLSCDIRIASSKAKFGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEAL 173 L+ D+RIAS A F + V LGI PG GG L R +G A E+ TG ++A+ AL Sbjct: 157 LTAMADMRIASETAWFAESFVKLGIIPGDGGAWFLPRLVGPARAAEMTLTGDRVDAKTAL 216 Query: 174 RIGLVNKVVEPDKLLEEAKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAEVFG 233 GLV++VV P+ L+ EA+AL D + VN P AVRM K + + + + + A + Sbjct: 217 EWGLVSRVVAPEDLMTEARALADRVAVNPPHAVRMAKKLLKESDGSSLSSLLELSAAMQP 276 Query: 234 ECFATEDRVEGMTAFVEKRDKAF 256 D E + AF++KRD F Sbjct: 277 LAHHAPDHAEAIDAFLDKRDPTF 299 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 302 Length adjustment: 26 Effective length of query: 233 Effective length of database: 276 Effective search space: 64308 Effective search space used: 64308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory