Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_101588722.1 BJEO58_RS06825 glucose 1-dehydrogenase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_900169175.1:WP_101588722.1 Length = 259 Score = 129 bits (324), Expect = 6e-35 Identities = 89/253 (35%), Positives = 127/253 (50%), Gaps = 22/253 (8%) Query: 9 IVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKAREL----GDNARFAVADISDEQ 64 I++GA SGLG ATA L + A ++LVD+NA +E ++ AD++ + Sbjct: 10 IITGAGSGLGQATALRLAQEDANLVLVDMNADGLEETRTQVESAGAGGVELVTADVTKSE 69 Query: 65 AAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFNLLRL 124 Q VDAA++ FGS+ G N AGI G + + G FAKV+ VNL G F + Sbjct: 70 DVQKYVDAALTTFGSVDGFFNNAGIEGRQNLTEDFGDD---EFAKVLAVNLTGVFAGMAA 126 Query: 125 AAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELARFGI 184 M + G I+NTAS+ G Q+ YAA+K + LT +ARE GI Sbjct: 127 VLKQMRRQGS------GAIVNTASVGGIRGVGNQSGYAAAKHGVVGLTRNSAREYGEHGI 180 Query: 185 RVMTIAPGIFETPMMAGMSDEVRAS--LAAGVPF-----PPRLGRPQEYAALARHII--E 235 R+ IAPG T M+ G ++ AAG F R G+P+E AAL ++ E Sbjct: 181 RINAIAPGAIMTAMVEGSLRQLGGEDWEAAGEEFVSANPMKRFGKPEEVAALVTFLLAEE 240 Query: 236 NSMLNGEVIRLDG 248 + +NG V+ +DG Sbjct: 241 SGFINGTVVPIDG 253 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 259 Length adjustment: 24 Effective length of query: 231 Effective length of database: 235 Effective search space: 54285 Effective search space used: 54285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory